RAB6IP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RAB6IP1 Antibody [NBP2-30981] - Immunofluorescent staining of human cell line HeLa shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: RAB6IP1 Antibody [NBP2-30981] - Staining of human salivary gland shows distinct luminal membranous positivity in glandular duct cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB6IP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MHNAEYDVLHAPPADDRDQSSMEDGEDTPVTKLQR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DENND5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAB6IP1 Protein (NBP2-30981PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB6IP1 Antibody

  • DENN domain-containing protein 5A
  • DENN/MADD domain containing 5A
  • FLJ22354
  • FLJ33829
  • FLJ43455
  • KIAA1091Rab6-interacting protein 1
  • RAB6 interacting protein 1
  • RAB6IP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89788
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81005
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20042
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92308
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-90976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56548
Species: Hu
Applications: ICC/IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for RAB6IP1 Antibody (NBP2-30981) (0)

There are no publications for RAB6IP1 Antibody (NBP2-30981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB6IP1 Antibody (NBP2-30981) (0)

There are no reviews for RAB6IP1 Antibody (NBP2-30981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RAB6IP1 Antibody (NBP2-30981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB6IP1 Products

Bioinformatics Tool for RAB6IP1 Antibody (NBP2-30981)

Discover related pathways, diseases and genes to RAB6IP1 Antibody (NBP2-30981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RAB6IP1 Antibody (NBP2-30981)

View related products by pathway.

Blogs on RAB6IP1

There are no specific blogs for RAB6IP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB6IP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DENND5A
Uniprot