Rab5a Antibody (5D1)

Images

 
Western Blot: Rab5a Antibody (5D1) [H00005868-M09A] - Analysis of RAB5A expression in K-562 (Cat # L009V1).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
5D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rab5a Antibody (5D1) Summary

Immunogen
RAB5A (AAH01267 116 a.a. - 215 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Marker
Early Endosome Marker
Specificity
RAB5A - RAB5A, member RAS oncogene family (5D1)
Isotype
IgM Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB5A
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00005868-M09A.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rab5a Antibody (5D1)

  • RAB5A, member RAS oncogene family
  • RAB5RAS-associated protein RAB5A
  • ras-related protein Rab-5A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Rab5a Antibody (H00005868-M09A)(1)

Reviews for Rab5a Antibody (H00005868-M09A) (0)

There are no reviews for Rab5a Antibody (H00005868-M09A). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab5a Antibody (H00005868-M09A) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rab5a Products

Bioinformatics Tool for Rab5a Antibody (H00005868-M09A)

Discover related pathways, diseases and genes to Rab5a Antibody (H00005868-M09A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab5a Antibody (H00005868-M09A)

Discover more about diseases related to Rab5a Antibody (H00005868-M09A).
 

Pathways for Rab5a Antibody (H00005868-M09A)

View related products by pathway.

PTMs for Rab5a Antibody (H00005868-M09A)

Learn more about PTMs related to Rab5a Antibody (H00005868-M09A).
 

Research Areas for Rab5a Antibody (H00005868-M09A)

Find related products by research area.

Blogs on Rab5a

There are no specific blogs for Rab5a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rab5a Antibody (5D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB5A
Entrez
Uniprot