RAB34 Antibody (3A5) - Azide and BSA Free

Sandwich ELISA: RAB34 Antibody (3A5) [H00083871-M06] - Detection limit for recombinant GST tagged RAB34 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 3A5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAB34 Antibody (3A5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RAB34 Antibody (3A5) - Azide and BSA Free (H00083871-M06) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RAB34 (NP_114140.2, 170 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAB34
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This antibody is useful for ELISA

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB34 Antibody (3A5) - Azide and BSA Free

• RAB34, member RAS oncogene family
• RAHRAB39Ras-related protein Rab-39
• ras-related protein Rab-34
• Ras-related protein Rah

Background

RAB proteins, like RAB34, are small GTPases that regulate vesicle budding, docking, and fusion along endocytosis and exocytosis pathways (Chen et al., 2003 [PubMed 12684051]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB34
• Uniprot:
  • NP_114140(Human)