RAB33A Antibody (8A11)

Images

 
Western Blot: RAB33A Antibody (8A11) [H00009363-M04] - Analysis of RAB33A expression in HL-60 (Cat # L014V1).
Sandwich ELISA: RAB33A Antibody (8A11) [H00009363-M04] - Detection limit for recombinant GST tagged RAB33A is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
8A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB33A Antibody (8A11) Summary

Immunogen
RAB33A (AAH09996, 1 a.a. ~ 238 a.a) full length recombinant protein with GST tag.MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVI GDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEK IKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFT NLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALK FADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLY RDAERQQGKVQKLEFPQEANSKTSCPC
Localization
Cell membrane; Lipid-anchor; Cytoplasmic side.
Specificity
RAB33A - RAB33A, member RAS oncogene family
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB33A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB33A Antibody (8A11)

  • MGC1488
  • RAB33A, member RAS oncogene family
  • RabS10
  • ras-related protein Rab-33A
  • Small GTP-binding protein S10

Background

The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20041
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-31733
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP1-71565
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-45926
Species: Hu, Mk
Applications: WB, IHC, IHC-P, IF

Publications for RAB33A Antibody (H00009363-M04) (0)

There are no publications for RAB33A Antibody (H00009363-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB33A Antibody (H00009363-M04) (0)

There are no reviews for RAB33A Antibody (H00009363-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB33A Antibody (H00009363-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB33A Products

Bioinformatics Tool for RAB33A Antibody (H00009363-M04)

Discover related pathways, diseases and genes to RAB33A Antibody (H00009363-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB33A Antibody (H00009363-M04)

Discover more about diseases related to RAB33A Antibody (H00009363-M04).
 

Pathways for RAB33A Antibody (H00009363-M04)

View related products by pathway.

PTMs for RAB33A Antibody (H00009363-M04)

Learn more about PTMs related to RAB33A Antibody (H00009363-M04).
 

Research Areas for RAB33A Antibody (H00009363-M04)

Find related products by research area.

Blogs on RAB33A

There are no specific blogs for RAB33A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB33A Antibody (8A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB33A
Entrez
OMIM
Uniprot