Recombinant Human Rab20 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Rab20 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-234 of Human RAB20 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RAB20
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
52.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Rab20 GST (N-Term) Protein

  • FLJ20429
  • RAB20, member RAS oncogene family
  • ras-related protein Rab-20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87174
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13253
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-85966
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
H00005873-M02
Species: Hu, Mu, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
NBL1-16657
Species: Hu
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02599
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, KD
H00004218-M02
Species: Hu, Mu, Ze
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-51634
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-85576
Species: Hu
Applications: WB
NB300-621
Species: Hu, Rt, Bv, Ca, Ha, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IM, IP

Publications for Rab20 Recombinant Protein (H00055647-P01) (0)

There are no publications for Rab20 Recombinant Protein (H00055647-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab20 Recombinant Protein (H00055647-P01) (0)

There are no reviews for Rab20 Recombinant Protein (H00055647-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab20 Recombinant Protein (H00055647-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Rab20 Products

Bioinformatics Tool for Rab20 Recombinant Protein (H00055647-P01)

Discover related pathways, diseases and genes to Rab20 Recombinant Protein (H00055647-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab20 Recombinant Protein (H00055647-P01)

Discover more about diseases related to Rab20 Recombinant Protein (H00055647-P01).
 

Pathways for Rab20 Recombinant Protein (H00055647-P01)

View related products by pathway.

Research Areas for Rab20 Recombinant Protein (H00055647-P01)

Find related products by research area.

Blogs on Rab20

There are no specific blogs for Rab20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Rab5a Antibody
NB120-13253
RAB7B Antibody (3B3)
H00338382-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Rab20 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB20