Recombinant Human RAB11FIP5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RAB11FIP5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 554-652 of Human RAB11FIP5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAB11FIP5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAB11FIP5 Protein

  • DKFZp434H018
  • Gaf-1
  • GAF1rab11-FIP5
  • Gamma-SNAP-associated factor 1
  • KIAA0857gaf-1
  • Phosphoprotein pp75
  • pp75
  • RAB11 family interacting protein 5 (class I)
  • Rab11-FIP5
  • Rab11-interacting protein Rip11
  • RAB11RIP5
  • RIP11rab11 family-interacting protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52546
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-82949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NBP1-84495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83998
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87746
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-15085
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32493
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00339122-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA

Publications for RAB11FIP5 Partial Recombinant Protein (H00026056-Q01) (0)

There are no publications for RAB11FIP5 Partial Recombinant Protein (H00026056-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB11FIP5 Partial Recombinant Protein (H00026056-Q01) (0)

There are no reviews for RAB11FIP5 Partial Recombinant Protein (H00026056-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB11FIP5 Partial Recombinant Protein (H00026056-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB11FIP5 Products

Bioinformatics Tool for RAB11FIP5 Partial Recombinant Protein (H00026056-Q01)

Discover related pathways, diseases and genes to RAB11FIP5 Partial Recombinant Protein (H00026056-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB11FIP5 Partial Recombinant Protein (H00026056-Q01)

Discover more about diseases related to RAB11FIP5 Partial Recombinant Protein (H00026056-Q01).
 

Pathways for RAB11FIP5 Partial Recombinant Protein (H00026056-Q01)

View related products by pathway.

PTMs for RAB11FIP5 Partial Recombinant Protein (H00026056-Q01)

Learn more about PTMs related to RAB11FIP5 Partial Recombinant Protein (H00026056-Q01).

Blogs on RAB11FIP5

There are no specific blogs for RAB11FIP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Glut4 Antibody
NBP1-49533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAB11FIP5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB11FIP5