QSOX1/Quiescin Q6 Antibody

Images

 
Immunohistochemistry: Quiescin Q6 Antibody [NBP2-13836] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

QSOX1/Quiescin Q6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERL IDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QSOX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
QSOX1/Quiescin Q6 Recombinant Protein Antigen (NBP2-13836PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for QSOX1/Quiescin Q6 Antibody

  • EC 1.8.3.2
  • FLJ34858
  • HQSOX
  • Q6
  • QSCN6
  • QSOX1
  • quiescin Q6 sulfhydryl oxidase 1
  • Quiescin Q6
  • sulfhydryl oxidase 1
  • Sulfhydryl Oxidase-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-90187
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1828
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF143
Species: Hu
Applications: WB, Simple Western, IHC
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for QSOX1/Quiescin Q6 Antibody (NBP2-13836) (0)

There are no publications for QSOX1/Quiescin Q6 Antibody (NBP2-13836).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QSOX1/Quiescin Q6 Antibody (NBP2-13836) (0)

There are no reviews for QSOX1/Quiescin Q6 Antibody (NBP2-13836). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for QSOX1/Quiescin Q6 Antibody (NBP2-13836) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional QSOX1/Quiescin Q6 Products

Bioinformatics Tool for QSOX1/Quiescin Q6 Antibody (NBP2-13836)

Discover related pathways, diseases and genes to QSOX1/Quiescin Q6 Antibody (NBP2-13836). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for QSOX1/Quiescin Q6 Antibody (NBP2-13836)

Discover more about diseases related to QSOX1/Quiescin Q6 Antibody (NBP2-13836).
 

Pathways for QSOX1/Quiescin Q6 Antibody (NBP2-13836)

View related products by pathway.

PTMs for QSOX1/Quiescin Q6 Antibody (NBP2-13836)

Learn more about PTMs related to QSOX1/Quiescin Q6 Antibody (NBP2-13836).
 

Research Areas for QSOX1/Quiescin Q6 Antibody (NBP2-13836)

Find related products by research area.

Blogs on QSOX1/Quiescin Q6

There are no specific blogs for QSOX1/Quiescin Q6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QSOX1/Quiescin Q6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QSOX1
Entrez