Pyruvate Dehydrogenase E2 Recombinant Protein Antigen

Images

 
There are currently no images for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Pyruvate Dehydrogenase E2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DLAT.

Source: E.coli

Amino Acid Sequence: LLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPT

Protein/Peptide Type
Recombinant Protein Antigen
Gene
DLAT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-34065. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen

  • 70 kDa mitochondrial autoantigen of primary biliary cirrhosis
  • dihydrolipoamide S-acetyltransferase
  • DLTA
  • E2 component of pyruvate dehydrogenase complex
  • EC 2.3.1
  • M2 antigen complex 70 kDa subunit
  • PBC
  • PDC-E2EC 2.3.1.12
  • PDCE2mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-66340
Species: Hu
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP) (0)

There are no publications for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP) (0)

There are no reviews for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP)

Discover related pathways, diseases and genes to Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP)

Discover more about diseases related to Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP).
 

Pathways for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP)

View related products by pathway.

PTMs for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP)

Learn more about PTMs related to Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP).
 

Research Areas for Pyruvate Dehydrogenase E2 Recombinant Protein Antigen (NBP2-34065PEP)

Find related products by research area.

Blogs on Pyruvate Dehydrogenase E2

There are no specific blogs for Pyruvate Dehydrogenase E2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Pyruvate Dehydrogenase E2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DLAT