Pyridoxal Kinase/PDXK Antibody

Product Discontinued

Pyridoxal Kinase/PDXK Antibody Summary

• Immunogen: Synthetic peptides corresponding to PDXK(pyridoxal (pyridoxine, vitamin B6) kinase) The peptide sequence was selected from the N terminal of PDXK. Peptide sequence PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK.
• Predicted Species: Rat (92%), Canine (93%), Sheep (100%), Equine (93%), Bovine (100%), Guinea Pig (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDXK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against PDXK and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Pyridoxal Kinase/PDXK Antibody

• C21orf124
• C21orf97
• chromosome 21 open reading frame 124
• DKFZp566A071
• EC 2.7.1.35
• FLJ21324
• FLJ37311
• HEL-S-1a
• MGC15873
• MGC31754
• MGC52346
• PDXK
• PKH
• PKHchromosome 21 open reading frame 97
• PNK
• PNKhuman pyridoxal kinase, EC 2.7.1.3510FLJ31940
• PRED79
• pyridoxal (pyridoxine, vitamin B6) kinase
• Pyridoxal Kinase
• pyridoxamine kinase
• Pyridoxine kinase
• Vitamin B6 Kinase

Background

PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDXK
• Uniprot:
  • O00764()