Recombinant Human Pygopus-2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Pygopus-2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 406 of Human PYGO2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAASAPPPPDKLEGGGGPAPPPAPPSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVDHLVASNPFEDDFGAPKVGVAAPPFLGSPVPFGGFRVQGGMAGQVPPGYSTGGGGGPQPLRRQPPPFPPNPMGPAFNMPPQGPGYPPPGNMNFPSQPFNQPLGQNFSPPSGQMMPGPVGGFGPMISPTMGQPPRAELGPPSLSQRFAQPGAPFGPSPLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGSPAAAVNGNQPSFPPNSSGRGGGTPDANSLAPPGKAGGGSGPQPPPGLVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEIQSVYIREGMGQLVAANDG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PYGO2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pygopus-2 Protein

  • 1190004M21Rik
  • FLJ33226
  • PYGO2
  • pygopus 2
  • pygopus homolog 2 (Drosophila)
  • pygopus homolog 2
  • Pygopus2
  • Pygopus-2

Background

PYGO2( AAH32099, 1 a.a. - 407 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
MAB3617
Species: Hu, Mu
Applications: WB
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-14350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3996
Species: Hu
Applications: WB
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF1620
Species: Mu
Applications: WB, IHC
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-35010
Species: Hu
H00005956-R02
Species: Hu
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Pygopus-2 Recombinant Protein (H00090780-P01) (0)

There are no publications for Pygopus-2 Recombinant Protein (H00090780-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pygopus-2 Recombinant Protein (H00090780-P01) (0)

There are no reviews for Pygopus-2 Recombinant Protein (H00090780-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pygopus-2 Recombinant Protein (H00090780-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pygopus-2 Products

Bioinformatics Tool for Pygopus-2 Recombinant Protein (H00090780-P01)

Discover related pathways, diseases and genes to Pygopus-2 Recombinant Protein (H00090780-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pygopus-2 Recombinant Protein (H00090780-P01)

Discover more about diseases related to Pygopus-2 Recombinant Protein (H00090780-P01).
 

Pathways for Pygopus-2 Recombinant Protein (H00090780-P01)

View related products by pathway.

PTMs for Pygopus-2 Recombinant Protein (H00090780-P01)

Learn more about PTMs related to Pygopus-2 Recombinant Protein (H00090780-P01).

Blogs on Pygopus-2

There are no specific blogs for Pygopus-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pygopus-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PYGO2
Entrez