PUS1 Antibody

Images

 
Western Blot: PUS1 Antibody [NBP2-13831] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PUS1 Antibody [NBP2-13831] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PUS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQDPSACRYILEMYCEEPFVREGLEFAVIRVKGQSFMMHQIRKMVGLVVA IVKGYAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PUS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PUS1 Protein (NBP2-13831PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PUS1 Antibody

  • EC 5.4.99.12
  • MGC11268
  • mitochondrial tRNA pseudouridine synthase A
  • MLASA1
  • pseudouridylate synthase 1
  • tRNA pseudouridine synthase A, mitochondrial
  • tRNA pseudouridylate synthase I
  • tRNA uridine isomerase I
  • tRNA-uridine isomerase I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5540
Species: Mu
Applications: WB
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89313
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56693
Species: Hu
Applications: WB, ICC/IF, IHC
H00029978-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56536
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83997
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80866
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80956
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82525
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NBP1-89266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59559
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PUS1 Antibody (NBP2-13831) (0)

There are no publications for PUS1 Antibody (NBP2-13831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUS1 Antibody (NBP2-13831) (0)

There are no reviews for PUS1 Antibody (NBP2-13831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PUS1 Antibody (NBP2-13831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PUS1 Products

Bioinformatics Tool for PUS1 Antibody (NBP2-13831)

Discover related pathways, diseases and genes to PUS1 Antibody (NBP2-13831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PUS1 Antibody (NBP2-13831)

Discover more about diseases related to PUS1 Antibody (NBP2-13831).
 

Pathways for PUS1 Antibody (NBP2-13831)

View related products by pathway.

PTMs for PUS1 Antibody (NBP2-13831)

Learn more about PTMs related to PUS1 Antibody (NBP2-13831).
 

Research Areas for PUS1 Antibody (NBP2-13831)

Find related products by research area.

Blogs on PUS1

There are no specific blogs for PUS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PUS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PUS1