PTS Antibody

Images

 
Western Blot: PTS Antibody [NBP1-87187] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: PTS Antibody [NBP1-87187] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: PTS Antibody [NBP1-87187] - Staining of human kidney shows cytoplasmic and membranous positivity in cells of renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTS Protein (NBP1-87187PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTS Antibody

  • 6-pyruvoyl tetrahydrobiopterin synthase
  • 6-pyruvoyltetrahydropterin synthase
  • EC 4.2.3.12
  • FLJ97081
  • PTPSPTP synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
AF842
Species: Hu
Applications: WB
AF5535
Species: Hu
Applications: WB, Simple Western
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
AF8038
Species: Hu, Mu, Rt
Applications: WB
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-03828
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-87185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-33556
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87187
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTS Antibody (NBP1-87187) (0)

There are no publications for PTS Antibody (NBP1-87187).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTS Antibody (NBP1-87187) (0)

There are no reviews for PTS Antibody (NBP1-87187). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTS Antibody (NBP1-87187) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTS Products

Bioinformatics Tool for PTS Antibody (NBP1-87187)

Discover related pathways, diseases and genes to PTS Antibody (NBP1-87187). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTS Antibody (NBP1-87187)

Discover more about diseases related to PTS Antibody (NBP1-87187).
 

Pathways for PTS Antibody (NBP1-87187)

View related products by pathway.

PTMs for PTS Antibody (NBP1-87187)

Learn more about PTMs related to PTS Antibody (NBP1-87187).

Blogs on PTS

There are no specific blogs for PTS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTS