PTPN21 Antibody - BSA Free

Western Blot: PTPN21 Antibody [NBP2-83432] - WB Suggested Anti-PTPN21 Antibody. Titration: 1.0 ug/ml. Positive Control: ACHN Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PTPN21 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PTPN21 Antibody - BSA Free (NBP2-83432) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTPN21. Peptide sequence: FWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRLGSRHNTVTYGRFKITT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPN21
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PTPN21 Antibody - BSA Free

• dJ1175B15.2 (protein tyrosine phosphatase, non-receptor type 21)
• EC 3.1.3
• EC 3.1.3.48
• protein tyrosine phosphatase, non-receptor type 21
• Protein-tyrosine phosphatase D1
• PTPD1
• PTPD1protein tyrosine phosphatase D1
• PTPN21
• PTPRL10
• tyrosine-protein phosphatase non-receptor type 21

Background

PTPN21 is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an N-terminal domain, similar to cytoskeletal- associated proteins including band 4.1, ezrin, merlin, and radixin. This PTP was shown to specially interact with BMX/ETK, a member of Tec tyrosine kinase family characterized by a multimodular structures including PH, SH3, and SH2 domains. The interaction of this PTP with BMX kinase was found to increase the activation of STAT3, but not STAT2 kinase. Studies of the similar gene in mice suggested the possible roles of this PTP in liver regeneration and spermatogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPN21