PTPN12 Antibody (4G6)

Images

 
Western Blot: PTPN12 Antibody (4G6) [H00005782-M01] - Analysis of PTPN12 expression in transfected 293T cell line by PTPN12 monoclonal antibody (M01), clone 4G6.Lane 1: PTPN12 transfected lysate(88.1 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: PTPN12 Antibody (4G6) [H00005782-M01] - Analysis of monoclonal antibody to PTPN12 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PTPN12 Antibody (4G6) Summary

Immunogen
PTPN12 (NP_002826.2 682 a.a. - 779 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEW
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTPN12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTPN12 Antibody (4G6)

  • protein tyrosine phosphatase, non-receptor type 12
  • Protein-tyrosine phosphatase G1
  • PTPG1tyrosine-protein phosphatase non-receptor type 12
  • PTP-PESTEC 3.1.3.48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB7475
Species: Hu, Rt
Applications: WB
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
AF4937
Species: Hu
Applications: WB, IHC
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85764
Species: Hu
Applications: WB, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF1366
Species: Hu
Applications: WB, Simple Western, IHC
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-07463
Species: Hu
H00005782-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PTPN12 Antibody (H00005782-M01) (0)

There are no publications for PTPN12 Antibody (H00005782-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPN12 Antibody (H00005782-M01) (0)

There are no reviews for PTPN12 Antibody (H00005782-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTPN12 Antibody (H00005782-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTPN12 Products

Bioinformatics Tool for PTPN12 Antibody (H00005782-M01)

Discover related pathways, diseases and genes to PTPN12 Antibody (H00005782-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPN12 Antibody (H00005782-M01)

Discover more about diseases related to PTPN12 Antibody (H00005782-M01).
 

Pathways for PTPN12 Antibody (H00005782-M01)

View related products by pathway.

PTMs for PTPN12 Antibody (H00005782-M01)

Learn more about PTMs related to PTPN12 Antibody (H00005782-M01).

Blogs on PTPN12

There are no specific blogs for PTPN12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPN12 Antibody (4G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPN12
Uniprot