PTENP1 Antibody - Azide and BSA Free

Western Blot: PTENP1 Antibody [H00011191-B01P] - Analysis of PTENP1 expression in transfected 293T cell line by PTENP1 polyclonal antibody. Lane 1: PTENP1 transfected lysate(40.59 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PTENP1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PTENP1 Antibody - Azide and BSA Free (H00011191-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PTENP1 (AAH38293.1, 1 a.a. - 369 a.a.) full-length human protein. MGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIHNLCAERHYDTAKSNYRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGIMIYAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLVKNHVDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKMYSSNSGPTRWEDKFMYFEFPQPLPVCGGIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
• Specificity: PTENP1 - phosphatase and tensin homolog (mutated in multiple advanced cancers 1), pseudogene 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PTENP1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTENP1 Antibody - Azide and BSA Free

• phosphatase and tensin homolog pseudogene 1
• psiPTEN
• PTEN2
• PTH2, PTEN-rs

Background

PTENP1 is a highly homologous pseudogene of PTEN. PTEN was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. PTEN is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tension like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTENP1
• Entrez:
  • 11191(Human)