PTEN2/TPTE Antibody (1F8)

Images

 
Sandwich ELISA: PTEN2/TPTE Antibody (1F8) [H00007179-M01] - Detection limit for recombinant GST tagged TPTE is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PTEN2/TPTE Antibody (1F8) Summary

Immunogen
TPTE (NP_954868.1 434 a.a. - 533 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVLDNITTDKILIDVFDGLPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD
Specificity
TPTE - transmembrane phosphatase with tensin homology (1F8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TPTE
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTEN2/TPTE Antibody (1F8)

  • Cancer/testis antigen 44
  • EC 3.1.3.48
  • PTEN2
  • putative tyrosine-protein phosphatase TPTE
  • tensin, putative protein-tyrosine phosphatase
  • transmembrane phosphatase with tensin homologytensin, putative protein-tyrosine phosphatase, EC 3.1.3.4810CT44PTEN-related tyrosine phosphatase
  • Tumor antigen BJ-HCC-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-57829
Species: Hu
Applications: ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87899
Species: Hu
Applications: IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007179-M01
Species: Hu
Applications: ELISA

Publications for PTEN2/TPTE Antibody (H00007179-M01) (0)

There are no publications for PTEN2/TPTE Antibody (H00007179-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTEN2/TPTE Antibody (H00007179-M01) (0)

There are no reviews for PTEN2/TPTE Antibody (H00007179-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PTEN2/TPTE Antibody (H00007179-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTEN2/TPTE Products

Bioinformatics Tool for PTEN2/TPTE Antibody (H00007179-M01)

Discover related pathways, diseases and genes to PTEN2/TPTE Antibody (H00007179-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTEN2/TPTE Antibody (H00007179-M01)

Discover more about diseases related to PTEN2/TPTE Antibody (H00007179-M01).
 

Pathways for PTEN2/TPTE Antibody (H00007179-M01)

View related products by pathway.

PTMs for PTEN2/TPTE Antibody (H00007179-M01)

Learn more about PTMs related to PTEN2/TPTE Antibody (H00007179-M01).

Blogs on PTEN2/TPTE

There are no specific blogs for PTEN2/TPTE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTEN2/TPTE Antibody (1F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TPTE
Entrez
Uniprot