PSMD6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PSMD6 Antibody [NBP2-32677] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
Immunohistochemistry: PSMD6 Antibody [NBP2-32677] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMD6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PSMD6 Protein (NBP2-32677PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMD6 Antibody

  • 26S proteasome non-ATPase regulatory subunit 6
  • Breast cancer-associated protein SGA-113M
  • KIAA010726S proteasome regulatory subunit S10
  • p42A
  • p44S10
  • PFAAP4
  • Phosphonoformate immuno-associated protein 4
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 6,26S proteasome regulatory subunit RPN7
  • Proteasome regulatory particle subunit p44S10
  • Rpn7
  • S10
  • SGA-113M

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NBP1-57365
Species: Hu
Applications: WB
NB100-345
Species: Hu
Applications: WB, ChIP, IP
AF6574
Species: Mu
Applications: WB
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
H00006192-P01
Species: Hu

Publications for PSMD6 Antibody (NBP2-32677) (0)

There are no publications for PSMD6 Antibody (NBP2-32677).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD6 Antibody (NBP2-32677) (0)

There are no reviews for PSMD6 Antibody (NBP2-32677). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PSMD6 Antibody (NBP2-32677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMD6 Products

Bioinformatics Tool for PSMD6 Antibody (NBP2-32677)

Discover related pathways, diseases and genes to PSMD6 Antibody (NBP2-32677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD6 Antibody (NBP2-32677)

Discover more about diseases related to PSMD6 Antibody (NBP2-32677).
 

Pathways for PSMD6 Antibody (NBP2-32677)

View related products by pathway.

PTMs for PSMD6 Antibody (NBP2-32677)

Learn more about PTMs related to PSMD6 Antibody (NBP2-32677).

Blogs on PSMD6

There are no specific blogs for PSMD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD6