PSMD13 Antibody - BSA Free

Western Blot: PSMD13 Antibody [NBP2-95231] - Analysis of extracts of various cell lines, using PSMD13 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: PSMD13 Antibody [NBP2-95231] - Analysis of HeLa cells using PSMD13 . Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: PSMD13 Antibody [NBP2-95231] - Paraffin-embedded mouse lung using PSMD13 .

Immunocytochemistry/Immunofluorescence: PSMD13 Antibody [NBP2-95231] - Analysis of C6 cells using PSMD13 . Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: PSMD13 Antibody [NBP2-95231] - Paraffin-embedded human liver damage using PSMD13 .

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PSMD13 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PSMD13 Antibody - BSA Free (NBP2-95231) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human PSMD13 (NP_002808.3). MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMD13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PSMD13 Antibody - BSA Free

• HSPC027,26S proteasome regulatory subunit RPN9
• p40.5,26S proteasome subunit p40.5,26S proteasome regulatory subunit p40.5
• proteasome (prosome, macropain) 26S subunit, non-ATPase, 13,26S proteasome regulatory subunit S11
• Rpn9,26S proteasome non-ATPase regulatory subunit 13
• S11

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. Two transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMD13