PSMA/FOLH1/NAALADase I Recombinant Protein Antigen

Images

 
There are currently no images for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PSMA/FOLH1/NAALADase I Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMA/FOLH1/NAALADase I.

Source: E.coli

Amino Acid Sequence: ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FOLH1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Alternate Names for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen

  • Cell growth-inhibiting gene 27 protein
  • cell growth-inhibiting protein 27
  • EC 3.4.17.21
  • FGCP
  • folate hydrolase (prostate-specific membrane antigen) 1
  • Folate hydrolase 1
  • FOLH1
  • FOLHNAALADase I
  • Folylpoly-gamma-glutamate carboxypeptidase
  • GCP2
  • GCPII
  • GCPIImGCP
  • glutamate carboxylase II
  • glutamate carboxypeptidase 2
  • Glutamate carboxypeptidase II
  • Membrane glutamate carboxypeptidase
  • mopsm
  • NAALAD1
  • NAALAD1N-acetylated-alpha-linked acidic dipeptidase I
  • NAALADase I
  • NAALAdase
  • N-acetylated alpha-linked acidic dipeptidase 1
  • prostate specific membrane antigen variant F
  • Prostate-specific membrane antigen
  • PSMA
  • PSMAFGCP
  • PSMPteroylpoly-gamma-glutamate carboxypeptidase

Background

This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms. [provided by RefSeq].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NLS3208
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB
NBP2-22321
Species: Hu
Applications: ICC/IF, IP, WB
NB110-74730
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB7636
Species: Hu
Applications: IHC
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-83224
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

Publications for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP) (0)

There are no publications for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP) (0)

There are no reviews for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSMA/FOLH1/NAALADase I Products

Bioinformatics Tool for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP)

Discover related pathways, diseases and genes to PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP)

Discover more about diseases related to PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP).
 

Pathways for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP)

View related products by pathway.

PTMs for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP)

Learn more about PTMs related to PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP).
 

Research Areas for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP)

Find related products by research area.

Blogs on PSMA/FOLH1/NAALADase I.

Taking Biomarker Discovery From 2D to 3D: Increased Biological Activity of EVs Isolated From 3D Prostate Cancer Cultures
Jamshed Arslan, Pharm D, PhD Tissues within the human body are made of a three-dimensional (3D) arrangement of cells working together to perform vital functions. The commonly used 2D monolayer cultures have limited ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PSMA/FOLH1/NAALADase I Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FOLH1