Home » PSMA/FOLH1/NAALADase I » PSMA/FOLH1/NAALADase I Proteins » PSMA/FOLH1/NAALADase I Recombinant Protein Antigen

PSMA/FOLH1/NAALADase I Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

PSMA/FOLH1/NAALADase I Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMA/FOLH1/NAALADase I.

Source: E.coli

Amino Acid Sequence: ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FOLH1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Alternate Names for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen

  • Cell growth-inhibiting gene 27 protein
  • cell growth-inhibiting protein 27
  • EC 3.4.17.21
  • FGCP
  • folate hydrolase (prostate-specific membrane antigen) 1
  • Folate hydrolase 1
  • FOLH1
  • FOLHNAALADase I
  • Folylpoly-gamma-glutamate carboxypeptidase
  • GCP2
  • GCPII
  • GCPIImGCP
  • glutamate carboxylase II
  • glutamate carboxypeptidase 2
  • Glutamate carboxypeptidase II
  • Membrane glutamate carboxypeptidase
  • mopsm
  • NAALAD1
  • NAALAD1N-acetylated-alpha-linked acidic dipeptidase I
  • NAALADase I
  • NAALAdase
  • N-acetylated alpha-linked acidic dipeptidase 1
  • prostate specific membrane antigen variant F
  • Prostate-specific membrane antigen
  • PSMA
  • PSMAFGCP
  • PSMPteroylpoly-gamma-glutamate carboxypeptidase

Background

This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms. [provided by RefSeq].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(16 Publications)
Species: Hu
Applications: ELISA
PSAT1 Antibody
NBP1-32920
Western Blot: PSAT1 Antibody [NBP1-32920] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PSAT1 antibody [N1C3] diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PSAT1 Antibody [NBP1-32920] - Paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: PSAT1 Antibody [NBP1-32920] - NCI-N87 xenograft, using PSAT1antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western blot shows human plasma. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Human Protein S/PROS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4036) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Specific bands were detected for Protein S/PROS1 at approximately 80 & 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows human plasma, loaded at 0.2 mg/mL. A specific band was detected for Protein S/PROS1 at approximately 106 kDa (as indicated) using 2 µg/mL of Goat Anti-Human Protein S/PROS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4036) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(3 Publications)
Species: Hu
Applications: Simple Western, WB
PLAG1 Antibody
(3B7)
H00005324-M02
Immunohistochemistry: PLAG1 Antibody (3B7) [H00005324-M02] - Left, IHC showing TGFBR3 staining in whole tumor sections (upper panels, scale bars=5mm) and enlargement of selected areas (lower panels, scale bars=100um). Right, quantification of IHC TGFBR3 levels in TGFBR3-PLAG1 positive vs. negative tumors. P (high TGFBR3)=0.002, Fisher's exact test. n=5+34. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-017-01178-z), licensed under a CC-BY licence.
ELISA: PLAG1 Antibody (3B7) [H00005324-M02] - Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.
Western Blot: PLAG1 Antibody (3B7) [H00005324-M02] - Western Blot detection against Immunogen (36.52 KDa) .
(10 Publications)
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, WB

Puromycin-sensitive am ...
NBP2-13669
Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
MTHFR Antibody
(5D3)
NBP2-37607
Immunohistochemistry-Paraffin: MTHFR Antibody (5D3) [NBP2-37607] - Analysis of intima cancer tissues (left) and prostate tissues (right) using MTHFR mouse mAb with DAB staining.
ELISA: MTHFR Antibody (5D3) [NBP2-37607] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: MTHFR Antibody (5D3) [NBP2-37607] - Western blot analysis using MTHFR mAb against HEK293 (1) and MTHFR(AA: 339-499)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB
mGluR3 Antibody -
BSA Free
NLS3208
Immunohistochemistry-Paraffin: mGluR3 Antibody [NLS3208] - Analysis of anti-GRM3 / MGLUR3 antibody with transfection control.
Immunohistochemistry-Paraffin: mGluR3 Antibody [NLS3208] - Analysis of anti-GRM3 / MGLUR3 antibody with HEK293 human embryonic kidney cells transfected with GRM3 / MGLUR3.
Immunohistochemistry-Paraffin: mGluR3 Antibody [NLS3208] - Analysis of anti-GRM3 / MGLUR3 antibody with human brain, coroid plexus at 38 ug/ml.
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB
GOLGB1/Giantin
Antibody
NBP2-22321
Immunocytochemistry/Immunofluorescence: GOLGB1/Giantin Antibody [NBP2-22321] - Untreated MDA-MB-231 cells showed perinuclear colonization of Giantin and other proteins, demonstrating this cell line exhibits the architecture of a typical Golgi apparatus. Cells were fixed, permeabilized, and immunolabeled with rabbit polyclonal antibody to Giantin. Secondary antibodies in other channels. Nuclei were stained with DAPI (gray channel). Fluorescence microscopy was used to examine stained cells. The final row is a merged image form the previous 3 rows. Overlapping of different combinations of rows indicated in different colors. Bar: 10 um.Citation: Luchsinger C, Aguilar M, Burgos PV, Ehrenfeld P, Mardones GA (2018) Functional disruption of the Golgi apparatus protein ARF1 sensitizes MDA-MB-231 breast cancer cells to the antitumor drugs Actinomycin D and Vinblastine through ERK and AKT signaling. PLoS ONE 13(4): e0195401.
Immunocytochemistry/Immunofluorescence: GOLGB1/Giantin Antibody [NBP2-22321] - Effect of ActD on the perinuclear localization of the Golgi apparatus of MDA-MB-231 cells assessed by immunofluorescence to Giantin, GM130 and TGN46. Cells were fixed, permeabilized, and immunolabeled with rabbit polyclonal antibody to Giantin. The final row is a merged image form the previous 3 rows. Overlapping of different combinations of rows indicated in different colors. Bar: 10 um.Citation: Luchsinger C, Aguilar M, Burgos PV, Ehrenfeld P, Mardones GA (2018) Functional disruption of the Golgi apparatus protein ARF1 sensitizes MDA-MB-231 breast cancer cells to the antitumor drugs Actinomycin D and Vinblastine through ERK and AKT signaling. PLoS ONE 13(4): e0195401.
Immunocytochemistry/Immunofluorescence: GOLGB1/Giantin Antibody [NBP2-22321] - Shows the combination effects of antitumor drugs and ARF1 disruptors on the MDA-MB-231 cells Golgi apparatus. Cells were fixed, permeabilized, and immunolabeled with rabbit polyclonal antibody to Giantin. The final row is a merged image form the previous 3 rows. Overlapping of different combinations of rows indicated in different colors. Bar: 10 um.Citation: Luchsinger C, Aguilar M, Burgos PV, Ehrenfeld P, Mardones GA (2018) Functional disruption of the Golgi apparatus protein ARF1 sensitizes MDA-MB-231 breast cancer cells to the antitumor drugs Actinomycin D and Vinblastine through ERK and AKT signaling. PLoS ONE 13(4): e0195401.
(2 Reviews)
(5 Publications)
Species: Hu
Applications: ICC/IF, IP, WB
Opsin 1 (Medium
Wave) Antibody
NB110-74730
Immunohistochemistry-Paraffin: Opsin 1 (Medium Wave) Antibody [NB110-74730] - IHC-P on paraffin sections of rat eye. The animal was perfused at a pressure of 130 mmHg with 300 ml 4% FA before being processed for paraffin embedding. HIER: Tris-EDTA, pH 9 for 20 min. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um. Primary antibody: dilution 1: 500, incubated 30 min at RT. Sections were counterstained with Harris Hematoxylin.
Immunohistochemistry-Paraffin: Opsin 1 (Medium Wave) Antibody [NB110-74730] - IHC-P on paraffin sections of rat eye. The animal was perfused at a pressure of 130 mmHg with 300 ml 4% FA before being processed for paraffin embedding. HIER: Tris-EDTA, pH 9 for 20 min. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um. Primary antibody: dilution 1: 500, incubated 30 min at RT. Sections were counterstained with Harris Hematoxylin.
Immunohistochemistry-Paraffin: Opsin 1 (Medium Wave) Antibody [NB110-74730] - IHC-P on paraffin sections of rat eye. The animal was perfused at a pressure of 130 mmHg with 300 ml 4% FA before being processed for paraffin embedding. HIER: Tris-EDTA, pH 9 for 20 min. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um. Primary antibody: dilution 1: 500, incubated 30 min at RT. Sections were counterstained with Harris Hematoxylin.
(3 Reviews)
(14 Publications)
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(13 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
PSCA Antibody
(741009)
MAB7636
PSCA was detected in immersion fixed paraffin-embedded sections of human prostate using Mouse Anti-Human PSCA Monoclonal Antibody (Catalog # MAB7636) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to the cell membranes of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Cbx8 Antibody
NBP1-83224
Immunocytochemistry/Immunofluorescence: Cbx8 Antibody [NBP1-83224] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cbx8 Antibody [NBP1-83224] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Cbx8 Antibody [NBP1-83224] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Proprotein
Convertase 1/PCSK1 An ...
H00005122-M02
Immunocytochemistry/Immunofluorescence: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on HeLa cell. Antibody concentration 30 ug/ml.
Immunohistochemistry-Paraffin: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Sandwich ELISA: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Detection limit for recombinant GST tagged PCSK1 is approximately 0.03ng/ml as a capture antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

Publications for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP) (0)

There are no publications for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP) (0)

There are no reviews for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSMA/FOLH1/NAALADase I Products

Bioinformatics Tool for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP)

Discover related pathways, diseases and genes to PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP)

Discover more about diseases related to PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP).
 

Pathways for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP)

View related products by pathway.

PTMs for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP)

Learn more about PTMs related to PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP).
 

Research Areas for PSMA/FOLH1/NAALADase I Recombinant Protein Antigen (NBP2-88924PEP)

Find related products by research area.

Blogs on PSMA/FOLH1/NAALADase I.

Check out the latest blog posts on PSMA/FOLH1/NAALADase I.
Taking Biomarker Discovery From 2D to 3D: Increased Biological Activity of EVs Isolated From 3D Prostate Cancer Cultures
Jamshed Arslan, Pharm D, PhD Tissues within the human body are made of a three-dimensional (3D) arrangement of cells working together to perform vital functions. The commonly used 2D monolayer cultures have limited ...  Read full blog post.

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: Opsin 1 (Medium Wave) Antibody [NB110-74730] - IHC-P on paraffin sections of rat eye. The animal was perfused at a pressure of 130 mmHg with 300 ml 4% FA before being processed for paraffin embedding. HIER: Tris-EDTA, pH 9 for 20 min. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um. Primary antibody: dilution 1: 500, incubated 30 min at RT. Sections were counterstained with Harris Hematoxylin.
Opsin 1 (Medium Wave) Antibody
NB110-74730
Western Blot: PSMA/FOLH1/NAALADase I Antibody (GCP-04) [NBP1-45057] - Analysis of human PSMA using mouse monoclonal antibody GCP-04 on lysates of LNCaP cell line and Jurkat cell line (PSMA non-expressing cell line; negative control) under reducing and non-reducing conditions. Nitrocellulose membrane was probed with 2 ug/ml of mouse anti-PSMA monoclonal antibody followed by IRDye800-conjugated anti-mouse secondary antibody.
PSMA/FOLH1/NAALADase I Antibody (GCP-04) - BSA Free
NBP1-45057
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR Antibody [Unconjugated]
AF231

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PSMA/FOLH1/NAALADase I Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FOLH1