Recombinant Human PSCA Protein

Images

 
SDS-Page: PSCA Partial Recombinant Protein [H00008000-Q01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PSCA Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 23-95 of Human PSCA

Source: Wheat Germ

Amino Acid Sequence: CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PSCA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
33.77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PSCA Protein

  • PRO232
  • prostate stem cell antigen
  • PSCA

Background

PSCA - prostate stem cell antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
NB110-68135
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for PSCA Partial Recombinant Protein (H00008000-Q01) (0)

There are no publications for PSCA Partial Recombinant Protein (H00008000-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSCA Partial Recombinant Protein (H00008000-Q01) (0)

There are no reviews for PSCA Partial Recombinant Protein (H00008000-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSCA Partial Recombinant Protein (H00008000-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSCA Products

Bioinformatics Tool for PSCA Partial Recombinant Protein (H00008000-Q01)

Discover related pathways, diseases and genes to PSCA Partial Recombinant Protein (H00008000-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSCA Partial Recombinant Protein (H00008000-Q01)

Discover more about diseases related to PSCA Partial Recombinant Protein (H00008000-Q01).
 

Pathways for PSCA Partial Recombinant Protein (H00008000-Q01)

View related products by pathway.

PTMs for PSCA Partial Recombinant Protein (H00008000-Q01)

Learn more about PTMs related to PSCA Partial Recombinant Protein (H00008000-Q01).
 

Research Areas for PSCA Partial Recombinant Protein (H00008000-Q01)

Find related products by research area.

Blogs on PSCA

There are no specific blogs for PSCA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PSCA Antibody
NBP2-33786

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PSCA Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PSCA
Entrez