PSCA Antibody (5C2) - Azide and BSA Free

Western Blot: PSCA Antibody (5C2) [H00008000-M03] - Analysis of PSCA expression in transfected 293T cell line by PSCA monoclonal antibody (M03), clone 5C2. Lane 1: PSCA transfected lysatE (12.9 KDa). Lane 2: Non-transfected lysate.

ELISA: PSCA Antibody (5C2) [H00008000-M03] - Detection limit for recombinant GST tagged PSCA is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, MA
• Clone: 5C2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PSCA Antibody (5C2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PSCA (NP_005663, 23 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
• Localization: Cell membrane; Lipid-anchor, GPI-anchor.
• Marker: Prostate Stem Cell Marker
• Specificity: PSCA - prostate stem cell antigen
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PSCA
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Protein Array
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSCA Antibody (5C2) - Azide and BSA Free

• PRO232
• prostate stem cell antigen
• PSCA

Background

This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene has a nonsynonymous nucleotide polymorphism at its start codon.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PSCA Antibody (H00008000-M03)(2)

Publications using H00008000-M03

• John M, Dileshni T, Anthony P et al. Pre-conditioning Modifies the Tumor Microenvironment to Enhance Solid Tumor CAR T Cell Efficacy and Endogenous Protective Immunity. Mol Ther. 2021-02-27 [PMID: 33647456]
• Klee, George G, Vasmatzis, George, Kosari et al. EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERS FreshPatents 2010-02-04 (ELISA, Human)

Bioinformatics

• Gene Symbol: PSCA
• Entrez:
  • 8000(Human)
• OMIM:
  • 602470(Human)
• Uniprot:
  • NP_005663(Human)