Recombinant Human PRSS33 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human PRSS33 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 280 of Human PRSS33 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRGVSCLQVLLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWIQARVSF

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
PRSS33
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
56.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRSS33 GST (N-Term) Protein

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.4
  • EOS
  • protease, serine, 33
  • serine protease 33
  • Serine protease EOS

Background

Serine protease that has amidolytic activity, cleaving its substrates before Arg residues

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M5000
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
NBP2-33778
Species: Hu
Applications: IHC, IHC-P, WB
NB600-922
Species: Ch
Applications: ELISA, IHC, IP, Single-Cell Western, WB
NBP2-21598
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
DY413
Species: Mu
Applications: ELISA
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
7954-GM/CF
Species: Hu
Applications: BA
203-IL
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MME00
Species: Mu
Applications: ELISA
796-IC
Species: Mu
Applications: BA
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
H00260429-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for PRSS33 Recombinant Protein (H00260429-P01) (0)

There are no publications for PRSS33 Recombinant Protein (H00260429-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRSS33 Recombinant Protein (H00260429-P01) (0)

There are no reviews for PRSS33 Recombinant Protein (H00260429-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRSS33 Recombinant Protein (H00260429-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRSS33 Products

Array H00260429-P01

Blogs on PRSS33

There are no specific blogs for PRSS33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRSS33 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS33