Recombinant Human PRSS33 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PRSS33 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 280 of Human PRSS33 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRGVSCLQVLLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWIQARVSF

Protein/Peptide Type
Recombinant Protein
Gene
PRSS33

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRSS33 Protein

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.4
  • EOS
  • protease, serine, 33
  • serine protease 33
  • Serine protease EOS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-21598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
796-IC
Species: Mu
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00006532-M06
Species: Hu
Applications: ELISA, IP

Publications for PRSS33 Recombinant Protein (H00260429-P01) (0)

There are no publications for PRSS33 Recombinant Protein (H00260429-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRSS33 Recombinant Protein (H00260429-P01) (0)

There are no reviews for PRSS33 Recombinant Protein (H00260429-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRSS33 Recombinant Protein (H00260429-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRSS33 Products

PRSS33 H00260429-P01

Bioinformatics Tool for PRSS33 Recombinant Protein (H00260429-P01)

Discover related pathways, diseases and genes to PRSS33 Recombinant Protein (H00260429-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRSS33

There are no specific blogs for PRSS33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRSS33 Antibody
NBP2-34099
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRSS33 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS33