Home » PRSS33 » PRSS33 Proteins » Recombinant Human PRSS33 Protein

Recombinant Human PRSS33 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human PRSS33 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 280 of Human PRSS33 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRGVSCLQVLLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWIQARVSF
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PRSS33
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
56.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRSS33 Protein

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.4
  • EOS
  • protease, serine, 33
  • serine protease 33
  • Serine protease EOS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-4 [Unconjugated]
204-IL
1 μg/lane of Recombinant Human IL-4 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-4 (Catalog # 204-IL) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.05-02 ng/mL.
(8 Reviews)
(281 Publications)
Species: Hu
RNASE3 Antibody
NBP2-33778
Western Blot: RNASE3 Antibody [NBP2-33778] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Staining in human bone marrow and cerebral cortex tissues using anti-RNASE3 antibody. Corresponding RNASE3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of hematopoietic cells.
Species: Hu
Applications: WB, IHC, IHC-P
Ovalbumin Antibody
NB600-922
Western Blot: Ovalbumin Antibody [NB600-922] - Lane 1: Reduced Ovalbumin. Load: 50 ng. Primary antibody: Ovalbumin antibody at 1:1,000 overnight at 4C. Secondary antibody: Peroxidase rabbit secondary antibody at 1:40,000 for 30 min at RT. Block: Blocking Buffer for Fluorescent Western Blotting for 30 min at RT. Predicted/Observed size: 45 kDa, 45 kDa for Ovalbumin.
Western Blot: Ovalbumin Antibody [NB600-922] - Western blot detection of Ovalbumin from hen egg white using NB600-922 at 1:10,000. The blot was blocked ON at 4 degrees C in 3% BSA. The secondary antibody used was a DyLight 649 Conjugated Goat anti-rabbit IgG (H&L) diluted 1:20,000 and incubated 1 hr RT in blocking buffer for fluorescent western blotting.
Western Blot: Ovalbumin Antibody [NB600-922] - Analysis using the HRP conjugate of NB600-922. Detection of Lane 1: Ovalbumin (Hen Egg). Load: 50 ng per lane. Dilution: 1:1,000. Predicted/Observed size: 43 kDa, 43 kDa for Ovalbumin. Other band(s): Ovalbumin splice variants and isoforms.
(4 Publications)
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(494 Publications)
Species: Hu
ABAT Antibody
NBP2-21598
Western Blot: ABAT Antibody [NBP2-21598] - Sample (20 ug of whole cell lysate) A: mouse brain 7. 5% SDS PAGE gel, diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: ABAT Antibody [NBP2-21598] - Immunofluorescence analysis of methanol-fixed Hep G2, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: ABAT Antibody [NBP2-21598] - Mouse kidney.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Ikaros/IKZF1
Antibody [Unconjugate
AF4984
Western blot shows lysates of Nalm‑6 human Pre‑B acute lymphocytic leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Bands were detected for Ikaros (1-8 spice forms) at approximately 37 to 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL PMA and 200 ng/mL calcium ionomycin for 30 minutes was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Ikaros/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The VPAC promoter was detected by standard PCR.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, loaded at 0.2 mg/mL. Specific bands were detected for Ikaros at approximately 63-77 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
IFN-gamma
[Unconjugated]
285-IF
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is 0.15‑0.75 ng/mL.
(5 Reviews)
(245 Publications)
Species: Hu
NDUFB6 Antibody
NBP1-92172
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
GM-CSF
[Unconjugated]
215-GM/CF
1 μg/lane of Recombinant Human GM-CSF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human GM-CSF (Catalog # 215-IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 6-30 pg/mL.
(204 Publications)
Species: Hu
IL-3 [Unconjugated]
203-IL/CF
1 μg/lane of Recombinant Human IL-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-3 (Catalog #203‑IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.02‑0.1 ng/mL.
(112 Publications)
Species: Hu
GM-CSF
[Unconjugated]
215-GM/CF
1 μg/lane of Recombinant Human GM-CSF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human GM-CSF (Catalog # 215-IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 6-30 pg/mL.
(204 Publications)
Species: Hu
Sialin/SLC17A5
Antibody
NBP2-20383
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: SLC17A5 Antibody [NBP2-20383] - Immunohistochemical analysis of paraffin-embedded BT474 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
ICAM-1/CD54
796-IC
ICAM-1/CD54
(51 Publications)
Species: Mu
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Western Blot: RanGAP1 Antibody (1B4) [NBP2-02623] Analysis of extracts (35ug) from 9 different cell lines by using anti-RanGAP1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: RanGAP1 Antibody (1B4) [NBP2-02623] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY RanGAP1.
Immunohistochemistry-Paraffin: RanGAP1 Antibody (1B4) [NBP2-02623] - Staining of paraffin-embedded Human prostate tissue using anti-RanGAP1 mouse monoclonal antibody.
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

SLC6A4/5-HTTLPR/Seroto ...
H00006532-D01P
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in mouse lung.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in transfected 293T cell line by SLC6A4 polyclonal antibody.Lane 1: SLC6A4 transfected lysate(70.30 KDa).Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu, Mu
Applications: WB

Publications for PRSS33 Recombinant Protein (H00260429-P01) (0)

There are no publications for PRSS33 Recombinant Protein (H00260429-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRSS33 Recombinant Protein (H00260429-P01) (0)

There are no reviews for PRSS33 Recombinant Protein (H00260429-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRSS33 Recombinant Protein (H00260429-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRSS33 Products

PRSS33 H00260429-P01

Bioinformatics Tool for PRSS33 Recombinant Protein (H00260429-P01)

Discover related pathways, diseases and genes to PRSS33 Recombinant Protein (H00260429-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRSS33

There are no specific blogs for PRSS33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRSS33 Recombinant Protein Antigen
NBP2-34099PEP
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
TNF-alpha [Unconjugated]
210-TA-005
Immunohistochemistry-Paraffin: PRSS33 Antibody [NBP2-34099] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
PRSS33 Antibody
NBP2-34099
1 μg/lane of Recombinant Human IL-4 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
IL-4 [Unconjugated]
204-IL-010

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRSS33 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol PRSS33