PRPS2 Antibody

Images

 
Western Blot: PRPS2 Antibody [NBP1-57670] - Jurkat cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRPS2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PRPS2(phosphoribosyl pyrophosphate synthetase 2) The peptide sequence was selected from the middle region of PRPS2. Peptide sequence ENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRPS2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PRPS2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRPS2 Antibody

  • EC 2.7.6.1
  • Phosphoribosyl pyrophosphate synthase II
  • phosphoribosyl pyrophosphate synthetase 2
  • PPRibP synthetase
  • PPRibP
  • PRSII
  • PRS-II
  • ribose-phosphate diphosphokinase 2
  • ribose-phosphate pyrophosphokinase 2

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13813
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00221823-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-80582
Species: Hu
Applications: IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67899
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02893
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32625
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP1-86177
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for PRPS2 Antibody (NBP1-57670) (0)

There are no publications for PRPS2 Antibody (NBP1-57670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRPS2 Antibody (NBP1-57670) (0)

There are no reviews for PRPS2 Antibody (NBP1-57670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRPS2 Antibody (NBP1-57670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PRPS2 Products

Bioinformatics Tool for PRPS2 Antibody (NBP1-57670)

Discover related pathways, diseases and genes to PRPS2 Antibody (NBP1-57670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRPS2 Antibody (NBP1-57670)

Discover more about diseases related to PRPS2 Antibody (NBP1-57670).
 

Pathways for PRPS2 Antibody (NBP1-57670)

View related products by pathway.

Research Areas for PRPS2 Antibody (NBP1-57670)

Find related products by research area.

Blogs on PRPS2

There are no specific blogs for PRPS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRPS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPS2
Uniprot