Home » PRPF4B » PRPF4B Antibodies » PRPF4B Antibody (3E10.)

PRPF4B Antibody (3E10.)

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: PRPF4B Antibody (3E10) [H00008899-M01] - Analysis of monoclonal antibody to PRPF4B on HeLa cell. Antibody concentration 10 ug/ml.
Immunocytochemistry/ Immunofluorescence: PRPF4B Antibody (3E10) [H00008899-M01] - Analysis of monoclonal antibody to PRPF4B on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: PRPF4B Antibody (3E10) [H00008899-M01] - Detection limit for recombinant GST tagged PRPF4B is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PRPF4B Antibody (3E10.) Summary

Immunogen
PRPF4B (NP_003904.2 898 a.a. - 1005 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
Specificity
PRPF4B - PRP4 pre-mRNA processing factor 4 homolog B (yeast) (3E10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRPF4B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRPF4B Antibody (3E10.)

  • dJ1013A10.1 (PRP4 protein kinase homolog)
  • dJ1013A10.1
  • KIAA0536EC 2.7.11.1
  • PR4H
  • protein-serine/threonine kinase
  • PRP4 kinase
  • PRP4 pre-mRNA processing factor 4 homolog B (yeast)
  • PRP4 pre-mRNA-processing factor 4 homolog
  • PRP4H
  • PRP4K
  • PRP4Prp4
  • serine/threonine-protein kinase PRP4 homolog

Background

Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PRPF3 Antibody
NBP1-83219
Western Blot: PRPF3 Antibody [NBP1-83219] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: PRPF3 Antibody [NBP1-83219] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: PRPF3 Antibody [NBP1-83219] - Staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PRPF4 Antibody
NBP1-83217
Western Blot: PRPF4 Antibody [NBP1-83217] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: PRPF4 Antibody [NBP1-83217] - Staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: PRPF4 Antibody [NBP1-83217] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PRPF6 Antibody
NBP1-92298
Western Blot: PRPF6 Antibody [NBP1-92298] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: PRPF6 Antibody [NBP1-92298] - Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: PRPF6 Antibody [NBP1-92298] - Staining in human fallopian tube and pancreas tissues using anti-PRPF6 antibody. Corresponding PRPF6 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SF2 Antibody
NBP2-20324
Western Blot: SF2 Antibody [NBP2-20324] - Rat tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with SF2 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: SF2 Antibody [NBP2-20324] - Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, using SF2 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: SF2 Antibody [NBP2-20324] - Paraffin-embedded mouse duodenum. SF2 antibody dilution: 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NCOR1 Antibody
NB100-58824
Western Blot: NCOR1 Antibody [NB100-58824] - Detection of Human and Mouse NCoR by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa and (50 ug) from mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-NCoR antibody NB100-58824 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: NCOR1 Antibody [NB100-58824] - Detection of Human NCOR on HeLa whole cell lysate using NB100-5882. NCOR was also immunoprecipitated by rabbit anti-NCOR antibody NB100-58825.
Western Blot: NCOR1 Antibody [NB100-58824] - Mouse whole cell lysate.
(3 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
PRPF31 Antibody
NBP1-82510
Western Blot: PRPF31 Antibody [NBP1-82510] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunohistochemistry-Paraffin: PRPF31 Antibody [NBP1-82510] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islets of Langerhans.
Western Blot: PRPF31 Antibody [NBP1-82510] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu
Applications: WB, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
EGF [Unconjugated]
236-EG
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
(10 Reviews)
(304 Publications)
Species: Hu
Pinin Antibody
NBP1-87784
Western Blot: Pinin Antibody [NBP1-87784] - Analysis in human cell line HepG2.
Immunocytochemistry/Immunofluorescence: Pinin Antibody [NBP1-87784] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human duodenum shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Brg1 Antibody
NB100-2594
Western Blot: Brg1 Antibody [NB100-2594] - Detection of Human and Mouse BRG1/SMARCA4 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells. Antibodies: Affinity purified rabbit anti-BRG1/SMARCA4 antibody NB100-2594 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: Brg1 Antibody [NB100-2594] - Sample: FFPE section of mouse plasmacytoma. Antibody: Affinity purified rabbit anti-BRG1/SMARCA4 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
Western Blot: Brg1 Antibody [NB100-2594] - Detection of Human and Mouse BRG1/SMARCA4 on HeLa whole cell lysate using NB100-2594.
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
SFRS8 Antibody
NB100-55245
Western Blot: SFRS8 Antibody [NB100-55245] - Whole cell lysate (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded) from HeLa cells. Affinity purified rabbit anti-SFRS8/SWAP antibody NB100-55245 used for WB at 0.04 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate (B).
Immunohistochemistry: SFRS8 Antibody [NB100-55245] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- SFRS8/SWAP used at a dilution of 1:200 (1ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: SFRS8 Antibody [NB100-55245] - FFPE section of human lung carcinoma. Affinity purified rabbit anti-SFRS8/SWAP used at a dilution of 1:100.
Species: Hu
Applications: WB, IHC, IHC-P, IP
AKT2 Antibody
[Unconjugated]
AF23151
Western blot shows lysates of MCF-7 human breast cancer cell line, MDA-MB-468 human breast cancer cell line, and U937 human histiocytic lymphoma cell line. PVDF membrane was probed with 0.5 µg/mL Goat Anti-Human/Mouse/Rat Akt2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF23151) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, Recombinant Human Active Akt1 (Catalog # 1775-KS), recombinant human Akt2, and recombinant human Akt3 (5 ng/lane) were included. A specific band for Akt2 was detected at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for Akt2 at approximately 60 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Akt2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF23151) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Akt2 was detected in immersion fixed paraffin-embedded sections of human kidney cancer tissue using 15 µg/mL Goat Anti-Human/Mouse/Rat Akt2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF23151) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to epithelial cells in tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
MBP Antibody (12)
NB600-717
Western Blot: MBP Antibody (12) [NB600-717] - Mouse Brain Tissue lysate probed with Rat anti MBP.
(1 Review)
(14 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
IGF-I
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(2 Reviews)
(104 Publications)
Species: Hu
Pleckstrin
Antibody (OTI6H8)
NBP2-02300
Western Blot: Pleckstrin Antibody (6H8) [NBP2-02300] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pleckstrin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pleckstrin.
Immunohistochemistry-Paraffin: Pleckstrin Antibody (6H8) [NBP2-02300] Staining of paraffin-embedded prostate tissue using anti-Pleckstrin mouse monoclonal antibody.
Flow Cytometry: Pleckstrin Antibody (6H8) [NBP2-02300] - HEK293T cells transfected with either pCMV6-ENTRY Pleckstrin.(Red) or empty vector control plasmid (Blue) were immunostained with anti-Pleckstrin mouse monoclonal, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
ARSF Antibody
NBP1-86191
Western Blot: ARSF Antibody [NBP1-86191] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: ARSF Antibody [NBP1-86191] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ARSF Antibody [NBP1-86191] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Species: Hu
Applications: ICC/IF
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Proteasome 19S S5A
Antibody
NBP1-90821
Immunocytochemistry/Immunofluorescence: Proteasome 19S S5A Antibody [NBP1-90821] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining in human testis and pancreas tissues using anti-PSMD4 antibody. Corresponding PSMD4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Proteasome 19S S5A Antibody [NBP1-90821] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Intersectin 2
Antibody
NBP1-71833
Western Blot: Intersectin 2 Antibody [NBP1-71833] - Detection of Human Intersectin 2 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Intersectin 2 antibody NBP1-71833 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: Intersectin 2 Antibody [NBP1-71833] - analysis of Intersectin 2 in mouse spleen lysates using anti-Intersectin 2 antibody. WT cells used as a positive control and ITSN2 knockdown sample used as a negative control. Image from verified customer review.
Western Blot: Intersectin 2 Antibody [NBP1-71833] - Whole cell lysate (5, 15 and 50) from HeLa cells. Antibody used at 0.04 ug/ml.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
PRPF4B Antibody
(3E10.)
H00008899-M01
PRPF4B Antibody (3E10.)
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PRPF4B Antibody (H00008899-M01) (0)

There are no publications for PRPF4B Antibody (H00008899-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRPF4B Antibody (H00008899-M01) (0)

There are no reviews for PRPF4B Antibody (H00008899-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRPF4B Antibody (H00008899-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PRPF4B Antibody (H00008899-M01)

Discover related pathways, diseases and genes to PRPF4B Antibody (H00008899-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRPF4B Antibody (H00008899-M01)

Discover more about diseases related to PRPF4B Antibody (H00008899-M01).
 

Pathways for PRPF4B Antibody (H00008899-M01)

View related products by pathway.

PTMs for PRPF4B Antibody (H00008899-M01)

Learn more about PTMs related to PRPF4B Antibody (H00008899-M01).
 

Research Areas for PRPF4B Antibody (H00008899-M01)

Find related products by research area.

Blogs on PRPF4B

There are no specific blogs for PRPF4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRPF4B Antibody (3E10.) and receive a gift card or discount.


Bioinformatics

Gene Symbol PRPF4B
Entrez
Uniprot