PRPF4B Antibody (3E10.)

Images

 
Immunocytochemistry/ Immunofluorescence: PRPF4B Antibody (3E10) [H00008899-M01] - Analysis of monoclonal antibody to PRPF4B on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: PRPF4B Antibody (3E10) [H00008899-M01] - Detection limit for recombinant GST tagged PRPF4B is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PRPF4B Antibody (3E10.) Summary

Immunogen
PRPF4B (NP_003904.2 898 a.a. - 1005 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
Specificity
PRPF4B - PRP4 pre-mRNA processing factor 4 homolog B (yeast) (3E10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRPF4B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRPF4B Antibody (3E10.)

  • dJ1013A10.1 (PRP4 protein kinase homolog)
  • dJ1013A10.1
  • KIAA0536EC 2.7.11.1
  • PR4H
  • protein-serine/threonine kinase
  • PRP4 kinase
  • PRP4 pre-mRNA processing factor 4 homolog B (yeast)
  • PRP4 pre-mRNA-processing factor 4 homolog
  • PRP4H
  • PRP4K
  • PRP4Prp4
  • serine/threonine-protein kinase PRP4 homolog

Background

Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB100-55245
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5540
Species: Mu
Applications: WB
NBP1-71833
Species: Hu, Mu
Applications: WB
H00008899-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PRPF4B Antibody (H00008899-M01) (0)

There are no publications for PRPF4B Antibody (H00008899-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRPF4B Antibody (H00008899-M01) (0)

There are no reviews for PRPF4B Antibody (H00008899-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRPF4B Antibody (H00008899-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRPF4B Products

Bioinformatics Tool for PRPF4B Antibody (H00008899-M01)

Discover related pathways, diseases and genes to PRPF4B Antibody (H00008899-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRPF4B Antibody (H00008899-M01)

Discover more about diseases related to PRPF4B Antibody (H00008899-M01).
 

Pathways for PRPF4B Antibody (H00008899-M01)

View related products by pathway.

PTMs for PRPF4B Antibody (H00008899-M01)

Learn more about PTMs related to PRPF4B Antibody (H00008899-M01).
 

Research Areas for PRPF4B Antibody (H00008899-M01)

Find related products by research area.

Blogs on PRPF4B

There are no specific blogs for PRPF4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRPF4B Antibody (3E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPF4B
Entrez
Uniprot