We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Protocadherin beta 11 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Protocadherin beta 11 Peptides and Proteins

Order Details


    • Catalog Number
      H00056125-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Protocadherin beta 11 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 27-126 of Human Protocadherin beta 11

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GSETWSFSVAEEMQSGSFVGNLAKDLGLKVRELSSRGARVVSNDKKQRLQLDINTGDLLLSETLDREELCGSIEPCVLHLQVLMQNPTQFLQIELQVRDI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCDHB11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Protocadherin beta 11 GST (N-Term) Protein

  • cadherin ME2
  • ME2
  • MGC138337
  • MGC142171
  • PCDH-BETA11
  • PCDH-beta-11
  • protocadherin beta 11
  • protocadherin beta-11

Background

This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections. PCDHB11( NP_061754, 27 a.a. - 127 a.a.) partial recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-19727
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
H00056110-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-69822
Species: Hu
Applications: ELISA
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-16797
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31661
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67344
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF1195
Species: Hu
Applications: ELISA, Neut, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00056125-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Protocadherin beta 11 Partial Recombinant Protein (H00056125-Q01) (0)

There are no publications for Protocadherin beta 11 Partial Recombinant Protein (H00056125-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin beta 11 Partial Recombinant Protein (H00056125-Q01) (0)

There are no reviews for Protocadherin beta 11 Partial Recombinant Protein (H00056125-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin beta 11 Partial Recombinant Protein (H00056125-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protocadherin beta 11 Products

Blogs on Protocadherin beta 11

There are no specific blogs for Protocadherin beta 11, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Protocadherin beta 11 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHB11