Recombinant Human Protocadherin alpha-9 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Protocadherin alpha-9 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 284-381 of Human Protocadherin alpha-9

Source: Wheat Germ

Amino Acid Sequence: DVSPDIKSKFHMDPLSGAITVIGHMDFEESRAHKIPVEAVDKGFPPLAGHCTLLVEVVDVNDNAPQLTIKTLSVPVKEDAQLGTVIALISVIDLDADA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCDHA9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Protocadherin alpha-9 Protein

  • KIAA0345-like 5
  • KIAA0345PCDH-ALPHA9
  • PCDH-alpha-9
  • protocadherin alpha 9
  • protocadherin alpha-9

Background

PCDHA9 - protocadherin alpha 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF482
Species: Mu
Applications: WB, IHC
NB110-58867
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30030
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-88626
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87262
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF6028
Species: Hu
Applications: WB, IHC
H00002158-M01
Species: Hu
Applications: WB, ELISA, IP, RNAi
H00009752-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Protocadherin alpha-9 Partial Recombinant Protein (H00009752-Q01) (0)

There are no publications for Protocadherin alpha-9 Partial Recombinant Protein (H00009752-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin alpha-9 Partial Recombinant Protein (H00009752-Q01) (0)

There are no reviews for Protocadherin alpha-9 Partial Recombinant Protein (H00009752-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin alpha-9 Partial Recombinant Protein (H00009752-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Protocadherin alpha-9 Partial Recombinant Protein (H00009752-Q01)

Discover related pathways, diseases and genes to Protocadherin alpha-9 Partial Recombinant Protein (H00009752-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin alpha-9 Partial Recombinant Protein (H00009752-Q01)

Discover more about diseases related to Protocadherin alpha-9 Partial Recombinant Protein (H00009752-Q01).
 

Pathways for Protocadherin alpha-9 Partial Recombinant Protein (H00009752-Q01)

View related products by pathway.

Blogs on Protocadherin alpha-9

There are no specific blogs for Protocadherin alpha-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Protocadherin alpha-9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHA9