Protocadherin 21 Antibody - BSA Free

Staining of human cell line HAP1 shows localization to the Golgi apparatus.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Protocadherin 21 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Protocadherin 21 using the following amino acid sequence: ATVPVTIRIVDLNNHPPTFYGESGPQNRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKVLTFKLLAVEVNTPEKFSSTADV
• Predicted Species: Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDHR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Protocadherin 21 Antibody - BSA Free

• cadherin-related family member 1
• CORD15
• KIAA1775DKFZp434A132
• PCDH21MT-protocadherin
• Photoreceptor cadherin
• prCAD
• PRCADprotocadherin-21
• protocadherin 21
• Protocadherin-21

Background

Protocadherin 21 is a member of the cadherin superfamily of calcium-dependent cell-cell adhesion molecules. The encoded protein has a signal peptide, six cadherin repeat domains and a unique cytoplasmic region. This non-classical cadherin appears to be exclusively expressed in the mitral and tufted cells in the main and accessory olfactory bulbs of the brain, suggesting a possible role in the formation and maintenance of neuronal networks. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDHR1