Recombinant Human Proteinase 3/Myeloblastin/PRTN3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Proteinase 3/Myeloblastin/PRTN3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 139-248 of Human PRTN3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR

Protein/Peptide Type
Partial Recombinant Protein
Gene
PRTN3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Proteinase 3/Myeloblastin/PRTN3 Protein

  • ACPA
  • AGP7
  • AGP7PR3
  • azurophil granule protein 7
  • C-ANCA
  • EC 3.4.21
  • EC 3.4.21.76
  • Leukocyte proteinase 3
  • MBN
  • MBT
  • Myeloblastin
  • Neutrophil proteinase 4
  • NP4
  • NP-4
  • P29C-ANCA antigen
  • PR-3CANCA
  • Proteinase 3
  • PRTN3
  • serine proteinase, neutrophil
  • Wegener autoantigen
  • Wegener granulomatosis autoantigen

Background

PRTN3 - proteinase 3 (serine proteinase, neutrophil, Wegener granulomatosis autoantigen)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
BPI
7468-BP
Species: Hu
AF2200
Species: Hu
Applications: WB, IP
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
AF1747
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF3505
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF5415
Species: Hu
Applications: WB, IHC, ICC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00005657-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01) (0)

There are no publications for Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01) (0)

There are no reviews for Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proteinase 3/Myeloblastin/PRTN3 Products

Bioinformatics Tool for Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01)

Discover related pathways, diseases and genes to Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01)

Discover more about diseases related to Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01).
 

Pathways for Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01)

View related products by pathway.

Research Areas for Proteinase 3/Myeloblastin/PRTN3 Partial Recombinant Protein (H00005657-Q01)

Find related products by research area.

Blogs on Proteinase 3/Myeloblastin/PRTN3

There are no specific blogs for Proteinase 3/Myeloblastin/PRTN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Proteinase 3/Myeloblastin/PRTN3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRTN3
Entrez