Protein Phosphatase 1 beta Antibody [Alexa Fluor® 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Protein Phosphatase 1 beta Primary Antibodies

Order Details


    • Catalog Number
      NBP3-35163AF488
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Protein Phosphatase 1 beta Antibody [Alexa Fluor® 488] Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 227-327 of human Protein Phosphatase 1 beta (NP_002700.1).

Sequence:
GADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1CB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Protein Phosphatase 1 beta Antibody [Alexa Fluor® 488]

  • EC 3.1.3.16
  • EC 3.1.3.53
  • MGC3672
  • PP1beta
  • PP-1Bprotein phosphatase 1, catalytic subunit, delta isoform
  • PPP1CD
  • protein phosphatase 1, catalytic subunit, beta isoform
  • protein phosphatase 1, catalytic subunit, beta isozyme
  • protein phosphatase 1-beta
  • protein phosphatase 1-delta
  • serine/threonine protein phosphatase PP1-beta catalytic subunit
  • serine/threonine-protein phosphatase PP1-beta catalytic subunit

Background

Protein phosphatase 1 (PP1) is a major eukaryotic protein serine/threonine phosphatase that regulates an enormous variety of cellular functions through the interaction of its catalytic subunit (PP1c) with over fifty different established or putative regulatory subunits (1). The coordinated and reciprocal action of serine/threonine (Ser/Thr) protein kinases and phosphatases produces transient phosphorylation, a fundamental regulatory mechanism for many biological processes. PP1 is ubiquitously distributed and regulates a broad range of cellular functions, including glycogen metabolism, cell-cycle progression and muscle relaxation. PP1 has evolved effective catalytic machinery but lacks substrate specificity. Substrate specificity is conferred upon PP1 through interactions with a large number of regulatory subunits (2). It has been shown that PP1 determines the efficacy of learning and memory by limiting acquisition and favoring memory decline. When PP1 is genetically inhibited during learning, short intervals between training episodes are sufficient for optimal performance (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45384
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF6465
Species: Hu, Rt
Applications: ICC, WB
H00050848-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, S-ELISA, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-35077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00054940-B01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-44092
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56745
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-02272
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-67503
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB

Publications for Protein Phosphatase 1 beta Antibody (NBP3-35163AF488) (0)

There are no publications for Protein Phosphatase 1 beta Antibody (NBP3-35163AF488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Phosphatase 1 beta Antibody (NBP3-35163AF488) (0)

There are no reviews for Protein Phosphatase 1 beta Antibody (NBP3-35163AF488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Protein Phosphatase 1 beta Antibody (NBP3-35163AF488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein Phosphatase 1 beta Products

Research Areas for Protein Phosphatase 1 beta Antibody (NBP3-35163AF488)

Find related products by research area.

Blogs on Protein Phosphatase 1 beta.

Myc-tag: The "Monkey Wrench" of Proteomic Tools
c-Myc is a well-characterized transcription factor encoded by the c-Myc gene on human chromosome 8q24. This cellular proto-oncogene, also known as p62, is commonly activated in a variety of tumor cells and plays a crucial role in cellular proliferatio...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein Phosphatase 1 beta Antibody [Alexa Fluor® 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1CB