Protein Phosphatase 1 beta Antibody

Images

 
Western Blot: Protein Phosphatase 1 beta Antibody [H00005500-B01P] - Analysis of PPP1CB expression in transfected 293T cell line by PPP1CB polyclonal antibody. Lane 1: PPP1CB transfected lysate(35.97 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Protein Phosphatase 1 beta Antibody Summary

Immunogen
PPP1CB (NP_002700.1, 1 a.a. - 327 a.a.) full-length human protein. MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Specificity
PPP1CB - protein phosphatase 1, catalytic subunit, beta isoform,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PPP1CB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Protein Phosphatase 1 beta Antibody

  • EC 3.1.3.16
  • EC 3.1.3.53
  • MGC3672
  • PP1beta
  • PP-1Bprotein phosphatase 1, catalytic subunit, delta isoform
  • PPP1CD
  • protein phosphatase 1, catalytic subunit, beta isoform
  • protein phosphatase 1, catalytic subunit, beta isozyme
  • protein phosphatase 1-beta
  • protein phosphatase 1-delta
  • serine/threonine protein phosphatase PP1-beta catalytic subunit
  • serine/threonine-protein phosphatase PP1-beta catalytic subunit

Background

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45384
Species: Hu
Applications: WB, IHC, IHC-P
AF6465
Species: Hu, Rt
Applications: WB, ICC
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
H00050848-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
NB110-61646
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
H00054940-B01P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-44092
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IP
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-16814
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67503
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00005500-B01P
Species: Hu
Applications: WB

Publications for Protein Phosphatase 1 beta Antibody (H00005500-B01P) (0)

There are no publications for Protein Phosphatase 1 beta Antibody (H00005500-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Phosphatase 1 beta Antibody (H00005500-B01P) (0)

There are no reviews for Protein Phosphatase 1 beta Antibody (H00005500-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protein Phosphatase 1 beta Antibody (H00005500-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Protein Phosphatase 1 beta Products

Bioinformatics Tool for Protein Phosphatase 1 beta Antibody (H00005500-B01P)

Discover related pathways, diseases and genes to Protein Phosphatase 1 beta Antibody (H00005500-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein Phosphatase 1 beta Antibody (H00005500-B01P)

Discover more about diseases related to Protein Phosphatase 1 beta Antibody (H00005500-B01P).
 

Pathways for Protein Phosphatase 1 beta Antibody (H00005500-B01P)

View related products by pathway.

PTMs for Protein Phosphatase 1 beta Antibody (H00005500-B01P)

Learn more about PTMs related to Protein Phosphatase 1 beta Antibody (H00005500-B01P).
 

Research Areas for Protein Phosphatase 1 beta Antibody (H00005500-B01P)

Find related products by research area.

Blogs on Protein Phosphatase 1 beta.

Myc-tag: The "Monkey Wrench" of Proteomic Tools
c-Myc is a well-characterized transcription factor encoded by the c-Myc gene on human chromosome 8q24. This cellular proto-oncogene, also known as p62, is commonly activated in a variety of tumor cells and plays a crucial role in cellular proliferatio...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein Phosphatase 1 beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1CB
Entrez
Uniprot