Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody - BSA Free

Western Blot: Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody [NBP2-68633] - Analysis in control (vector only transfected HEK293T lysate) and POGLUT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody [NBP2-68633] - Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody - BSA Free (NBP2-68633) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRGGISRKMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFIL
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POGLUT1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Recombinant Protein Antigen (NBP2-68633PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody - BSA Free

• 9630046K23Rik
• C3orf9
• CAP10-like protein, 46 kDa
• chromosome 3 open reading frame 9
• CLP46
• EC 2.4.1.-
• hCLP46CAP10-like 46 kDa protein
• KDELC family like 1
• KDELCL1
• KTEL (Lys-Tyr-Glu-Leu) containing 1
• KTEL motif-containing protein 1
• KTELC1
• MDS010
• MDSRP
• MDSRPKTELC1
• MGC32995
• Myelodysplastic syndromes relative protein
• POGLUT1
• protein O-glucosyltransferase 1
• Rumi
• x 010 protein

Background

KTELC1 may be involved in important physiological functions in the liver

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POGLUT1