GXYLT2 Antibody


Immunocytochemistry/ Immunofluorescence: GXYLT2 Antibody [NBP2-49553] - Staining of human cell line Hep G2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GXYLT2 Antibody [NBP2-49553] - Staining of human stomach shows membrane positivity in glandular cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

GXYLT2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQ
Specificity of human GXYLT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GXYLT2 Recombinant Protein Antigen (NBP2-49553PEP)

Reactivity Notes

Mouse (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GXYLT2 Antibody

  • EC 2.4.2.n2
  • GLT8D4
  • Glucoside Xylosyltransferase 2
  • Glycosyltransferase 8 Domain Containing 4
  • Glycosyltransferase 8 Domain-Containing Protein 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GXYLT2 Antibody (NBP2-49553) (0)

There are no publications for GXYLT2 Antibody (NBP2-49553).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GXYLT2 Antibody (NBP2-49553) (0)

There are no reviews for GXYLT2 Antibody (NBP2-49553). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GXYLT2 Antibody (NBP2-49553) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GXYLT2 Products

Bioinformatics Tool for GXYLT2 Antibody (NBP2-49553)

Discover related pathways, diseases and genes to GXYLT2 Antibody (NBP2-49553). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for GXYLT2 Antibody (NBP2-49553)

View related products by pathway.

PTMs for GXYLT2 Antibody (NBP2-49553)

Learn more about PTMs related to GXYLT2 Antibody (NBP2-49553).

Blogs on GXYLT2

There are no specific blogs for GXYLT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GXYLT2 Antibody and receive a gift card or discount.


Gene Symbol GXYLT2