Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody

Images

 
Western Blot: Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody [NBP1-90311] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: ...read more
Immunohistochemistry-Paraffin: Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody [NBP1-90311] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POGLUT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Protein (NBP1-90311PEP)
Publications
Read Publication using
NBP1-90311 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody

  • 9630046K23Rik
  • C3orf9
  • CAP10-like protein, 46 kDa
  • chromosome 3 open reading frame 9
  • CLP46
  • EC 2.4.1.-
  • hCLP46CAP10-like 46 kDa protein
  • KDELC family like 1
  • KDELCL1
  • KTEL (Lys-Tyr-Glu-Leu) containing 1
  • KTEL motif-containing protein 1
  • KTELC1
  • MDS010
  • MDSRP
  • MDSRPKTELC1
  • MGC32995
  • Myelodysplastic syndromes relative protein
  • POGLUT1
  • protein O-glucosyltransferase 1
  • Rumi
  • x 010 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00283464-P01
Species: Hu
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP2-49553
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5924
Species: Hu
Applications: WB, Simple Western
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready

Publications for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311) (0)

There are no reviews for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Products

Bioinformatics Tool for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311)

Discover related pathways, diseases and genes to Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311)

Discover more about diseases related to Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311).
 

Pathways for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311)

View related products by pathway.

PTMs for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311)

Learn more about PTMs related to Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311).

Blogs on Protein O-Glucosyltransferase 1/POGLUT1/KTELC1

There are no specific blogs for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POGLUT1
Entrez