Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody [NBP1-90311] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody [NBP1-90311] - Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Analysis in control (vector only transfected HEK293T lysate) and POGLUT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody - BSA Free (NBP1-90311) is a polyclonal antibody validated for use in IHC and WB. Anti-Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POGLUT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Protein (NBP1-90311PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%). Mouse reactivity reported in scientific literature (PMID: 29953591).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody - BSA Free

• 9630046K23Rik
• C3orf9
• CAP10-like protein, 46 kDa
• chromosome 3 open reading frame 9
• CLP46
• EC 2.4.1.-
• hCLP46CAP10-like 46 kDa protein
• KDELC family like 1
• KDELCL1
• KTEL (Lys-Tyr-Glu-Leu) containing 1
• KTEL motif-containing protein 1
• KTELC1
• MDS010
• MDSRP
• MDSRPKTELC1
• MGC32995
• Myelodysplastic syndromes relative protein
• POGLUT1
• protein O-glucosyltransferase 1
• Rumi
• x 010 protein

Background

KTELC1 may be involved in important physiological functions in the liver

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody (NBP1-90311)(3)

Publications using NBP1-90311

• Servian-Morilla E, Cabrera-Serrano M, Johnson K et al. POGLUT1 biallelic mutations cause myopathy with reduced satellite cells, alpha-dystroglycan hypoglycosylation and a distinctive radiological pattern Acta Neuropathol. 2020-01-03 [PMID: 31897643] (Human)
• Chammaa M, MalYsa A, Redondo C et al. RUMI is a novel negative prognostic marker and therapeutic target in non-small-cell lung cancer. J. Cell. Physiol. 2018-06-28 [PMID: 29953591] (IF/IHC, Mouse)
• Basmanav FB, Oprisoreanu AM, Pasternack SM et al. Mutations in POGLUT1, encoding protein O-glucosyltransferase 1, cause autosomal-dominant Dowling-Degos disease. Am. J. Hum. Genet. 2014-01-02 [PMID: 24387993] (WB, IHC-P, Human)

Bioinformatics

• Gene Symbol: POGLUT1