Proteasome beta 1 Recombinant Protein Antigen

Images

 
There are currently no images for Proteasome beta 1 Protein (NBP1-89714PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Proteasome beta 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMB1.

Source: E. coli

Amino Acid Sequence: YQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSMB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89714.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Proteasome beta 1 Recombinant Protein Antigen

  • EC 3.4.25.1
  • FLJ25321
  • HC5
  • KIAA1838
  • Macropain subunit C5
  • Multicatalytic endopeptidase complex subunit C5
  • PMSB1
  • proteasome (prosome, macropain) subunit, beta type, 1
  • proteasome beta 1 subunit
  • Proteasome beta 1
  • Proteasome component C5
  • Proteasome gamma chain
  • proteasome subunit beta type-1
  • proteasome subunit HC5
  • PSC5
  • PSMB1

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is tightly linked to the TBP (TATA-binding protein) gene in human and in mouse, and is transcribed in the opposite orientation in both species. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-92292
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP1-80819
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-86566
Species: Hu
Applications: IHC,  IHC-P, WB
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-19795
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5026
Species: Mu, Rt
Applications: IHC, WB
NBP2-01608
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NB600-1160
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-92293
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB110-68123
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB100-1110
Species: Hu, Rb
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, PLA, WB
NBP2-38234
Species: Hu
Applications: IHC,  IHC-P
AF8277
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB

Publications for Proteasome beta 1 Protein (NBP1-89714PEP) (0)

There are no publications for Proteasome beta 1 Protein (NBP1-89714PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome beta 1 Protein (NBP1-89714PEP) (0)

There are no reviews for Proteasome beta 1 Protein (NBP1-89714PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Proteasome beta 1 Protein (NBP1-89714PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proteasome beta 1 Products

Research Areas for Proteasome beta 1 Protein (NBP1-89714PEP)

Find related products by research area.

Blogs on Proteasome beta 1

There are no specific blogs for Proteasome beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Proteasome beta 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB1