Proteasome 20S beta2 Antibody [Allophycocyanin]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Allophycocyanin

Proteasome 20S beta2 Antibody [Allophycocyanin] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human Proteasome 20S beta2 (NP_002785.1).
  
  Sequence:
  MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for Proteasome 20S beta2 Antibody [Allophycocyanin]

• EC 3.4.25.1
• HC7-I
• Macropain subunit C7-I
• MGC104215
• MGC126885
• multicatalytic endopeptidase complex subunit C7-1
• Multicatalytic endopeptidase complex subunit C7-I
• proteasome (prosome, macropain) subunit, beta type, 2
• Proteasome 20S beta2
• proteasome beta 2 subunit
• Proteasome component C7-I
• proteasome subunit beta type-2
• proteasome subunit, beta type, 2
• PSMB2

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMB2