Prostasin/Prss8 Antibody

Images

 
Western Blot: Prostasin/Prss8 Antibody [NBP1-86340] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2
Immunohistochemistry: Prostasin/Prss8 Antibody [NBP1-86340] - Staining of human prostate shows distinct positivity in secretions from glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Prostasin/Prss8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRSS8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Prostasin/Prss8 Protein (NBP1-86340PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prostasin/Prss8 Antibody

  • CAP1
  • channel-activating protease 1
  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.120
  • Prostasin
  • protease, serine, 8
  • Prss8
  • Serine protease 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6386
Species: Hu
Applications: WB, IP
NBP2-30572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4158
Species: Hu
Applications: IHC
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBL1-14964
Species: Hu
AF1141
Species: Mu
Applications: WB, IHC, IP
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
AF3946
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
2980-PI
Species: Hu
H00003249-P01
Species: Hu
Applications: WB
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-58965
Species: Hu
Applications: WB, PEP-ELISA
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86340
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Prostasin/Prss8 Antibody (NBP1-86340) (0)

There are no publications for Prostasin/Prss8 Antibody (NBP1-86340).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prostasin/Prss8 Antibody (NBP1-86340) (0)

There are no reviews for Prostasin/Prss8 Antibody (NBP1-86340). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prostasin/Prss8 Antibody (NBP1-86340) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prostasin/Prss8 Products

Bioinformatics Tool for Prostasin/Prss8 Antibody (NBP1-86340)

Discover related pathways, diseases and genes to Prostasin/Prss8 Antibody (NBP1-86340). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prostasin/Prss8 Antibody (NBP1-86340)

Discover more about diseases related to Prostasin/Prss8 Antibody (NBP1-86340).
 

Pathways for Prostasin/Prss8 Antibody (NBP1-86340)

View related products by pathway.

PTMs for Prostasin/Prss8 Antibody (NBP1-86340)

Learn more about PTMs related to Prostasin/Prss8 Antibody (NBP1-86340).

Blogs on Prostasin/Prss8

There are no specific blogs for Prostasin/Prss8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prostasin/Prss8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS8
Entrez