Prominin 2 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Analysis in human skin and liver tissues using NBP2-38032 antibody. Corresponding Prominin 2 RNA-seq data are presented for ...read more
Immunocytochemistry/ Immunofluorescence: Prominin 2 Antibody [NBP2-38032] - Staining of human cell line MCF7 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Staining of human small intestine shows moderate positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Staining of human skin shows moderate membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Staining of human prostate shows moderate membranous positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related Prominin 2 Primary Antibodies
Validated by:
       

Orthogonal Strategies

 

Order Details


    • Catalog Number
      NBP2-38032
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Prominin 2 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Prominin 2 Antibody - BSA Free (NBP2-38032) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Prominin 2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ELGADFSQVPSVDHVLHQLKGVPEANFSSMVQEENSTFNALPALAAMQTSSVVQELKKAVAQQPEGVRTLAEGFP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PROM2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publication using NBP2-38032.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Prominin 2 Antibody - BSA Free

  • hPROML2
  • MGC138714
  • PROM2
  • PROM-2
  • Prominin 2
  • prominin-2
  • Prominin-like protein 2
  • prominin-related protein
  • PROML2

Background

Prominin 2 is a large-scale effort, termed the Secreted Protein Discovery Initiative (SPDI), was undertaken to identify novel secreted and transmembrane proteins. Several criteria were applied to identify and characterize these new and novel genes. First, a biological signal sequence trap in yeast cells was utilized to identify cDNA clones encoding putative secreted proteins, second strategy utilized various algorithms that recognize features such as the hydrophobic properties of signal sequences to identify putative proteins encoded by expressed sequence tags (ESTs) from human cDNA libraries and finally, ESTs for protein sequence similarity to a set of known receptors and their ligands with the BLAST algorithm. Based on these criteria isolation of full length cDNA clones for each of these genes resulted in identification of more than 1000 novel proteins. One of these new genes is Prominin2. Prominin 2 is a 112 kDa glycoporotein structurally related to Prominin 1 (CD133) although amino acid similarity is not more than 30% but their genomic organization is strikingly similar (1). Like Prominin1, the prominin 2 exhibit similar membrane topology with 5 trans-membrane domains and two large glycosylated extracellular domains. Similar to Prominin1 localization, the Prominin 2 is also associated with membrane protrusions of the epithelial cells from adult kidney, and all along the digestive track and other epithelial tissues. One striking difference between Prominin1 and Prominin 2 expression lies in its conspicuous absence in eye tissue (2). Prominin 2, along with other genes (AP1M2, MAL2, PRSS8 and FLJ20171) expression is differentially expressed in chromophobe renal cell carcinoma compared to benign oncocytoma consistently and this marker can be used to differentiate RCC form benign oncocytoma (3). Prominin 2 is an androgen-responsive genes proapoptotic membrane protein that is expressed in human prostate and human prostate cancer cell lines with highest levels in less aggressive LNCaP cell and low expression in highly aggressive PC3 and DU145 cells suggesting a role of Prominin 2 in down-regulation of aggressiveness of prostate cancer cells (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-16518
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF5175
Species: Mu
Applications: IHC, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
NBP2-93986
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-33286
Species: Hu
Applications: IHC,  IHC-P
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-270
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, In vitro, Simple Western, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
NBP1-44270
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, WB
NBP2-38234
Species: Hu
Applications: IHC,  IHC-P
NBP1-83224
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15275
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00004205-M15
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-46587
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-38032
Species: Hu
Applications: ICC/IF, IHC

Publications for Prominin 2 Antibody (NBP2-38032)(1)

Reviews for Prominin 2 Antibody (NBP2-38032) (0)

There are no reviews for Prominin 2 Antibody (NBP2-38032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Prominin 2 Antibody (NBP2-38032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prominin 2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PROM2
Uniprot