Prominin 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Analysis in human skin and liver tissues using NBP2-38032 antibody. Corresponding Prominin 2 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Prominin 2 Antibody [NBP2-38032] - Staining of human cell line MCF7 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Staining of human small intestine shows moderate positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Staining of human skin shows moderate membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Prominin 2 Antibody [NBP2-38032] - Staining of human prostate shows moderate membranous positivity in glandular cells.

Product Discontinued

Prominin 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Prominin 2 Antibody - BSA Free (NBP2-38032) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Prominin 2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELGADFSQVPSVDHVLHQLKGVPEANFSSMVQEENSTFNALPALAAMQTSSVVQELKKAVAQQPEGVRTLAEGFP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PROM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Prominin 2 Antibody - BSA Free

• hPROML2
• MGC138714
• PROM2
• PROM-2
• Prominin 2
• prominin-2
• Prominin-like protein 2
• prominin-related protein
• PROML2

Background

Prominin 2 is a large-scale effort, termed the Secreted Protein Discovery Initiative (SPDI), was undertaken to identify novel secreted and transmembrane proteins. Several criteria were applied to identify and characterize these new and novel genes. First, a biological signal sequence trap in yeast cells was utilized to identify cDNA clones encoding putative secreted proteins, second strategy utilized various algorithms that recognize features such as the hydrophobic properties of signal sequences to identify putative proteins encoded by expressed sequence tags (ESTs) from human cDNA libraries and finally, ESTs for protein sequence similarity to a set of known receptors and their ligands with the BLAST algorithm. Based on these criteria isolation of full length cDNA clones for each of these genes resulted in identification of more than 1000 novel proteins. One of these new genes is Prominin2. Prominin 2 is a 112 kDa glycoporotein structurally related to Prominin 1 (CD133) although amino acid similarity is not more than 30% but their genomic organization is strikingly similar (1). Like Prominin1, the prominin 2 exhibit similar membrane topology with 5 trans-membrane domains and two large glycosylated extracellular domains. Similar to Prominin1 localization, the Prominin 2 is also associated with membrane protrusions of the epithelial cells from adult kidney, and all along the digestive track and other epithelial tissues. One striking difference between Prominin1 and Prominin 2 expression lies in its conspicuous absence in eye tissue (2). Prominin 2, along with other genes (AP1M2, MAL2, PRSS8 and FLJ20171) expression is differentially expressed in chromophobe renal cell carcinoma compared to benign oncocytoma consistently and this marker can be used to differentiate RCC form benign oncocytoma (3). Prominin 2 is an androgen-responsive genes proapoptotic membrane protein that is expressed in human prostate and human prostate cancer cell lines with highest levels in less aggressive LNCaP cell and low expression in highly aggressive PC3 and DU145 cells suggesting a role of Prominin 2 in down-regulation of aggressiveness of prostate cancer cells (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Prominin 2 Antibody (NBP2-38032)(1)

Publication using NBP2-38032

• Justine Paris, Claire Wilhelm, Celeste Lebbé, Mohammed Elmallah, Frédéric Pamoukdjian, Audrey Héraud, Guillaume Gapihan, Aurore Van De Walle, Van Nhan Tran, Diaddin Hamdan, Clara Allayous, Maxime Battistella, Emmanuel Van Glabeke, Kah Wai Lim, Christophe Leboeuf, Sébastien Roger, Géraldine Falgarone, Anh Tuan Phan, Guilhem Bousquet PROM2 overexpression induces metastatic potential through epithelial‐to‐mesenchymal transition and ferroptosis resistance in human cancers Clinical and Translational Medicine 2024-03-21 [PMID: 38515278]

Bioinformatics

• Gene Symbol: PROM2
• Uniprot:
  • Q8N271(Human)