PRKRIR Antibody (1C10-1A6)

Images

 
There are currently no images for PRKRIR Antibody (H00005612-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1C10-1A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PRKRIR Antibody (1C10-1A6) Summary

Immunogen
PRKRIR (AAH21992, 1 a.a. - 150 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Specificity
PRKRIR - protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKRIR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRKRIR Antibody (1C10-1A6)

  • 58 kDa interferon-induced protein kinase-interacting protein
  • DAP452 kDa repressor of the inhibitor of the protein kinase
  • Death-associated protein 4
  • inhibitor of protein kinase PKR
  • MGC102750
  • P52rIPK
  • p58IPK-interacting protein
  • protein-kinase, interferon-inducible double stranded RNA dependent inhibitor
  • repressor of (P58 repressor)
  • THAP domain-containing protein 0
  • THAP0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-87132
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33860
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-82617
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-45514
Species: Hu
Applications: WB, IHC
NBP2-58498
Species: Hu
Applications: ICC/IF

Publications for PRKRIR Antibody (H00005612-M01) (0)

There are no publications for PRKRIR Antibody (H00005612-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRKRIR Antibody (H00005612-M01) (0)

There are no reviews for PRKRIR Antibody (H00005612-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRKRIR Antibody (H00005612-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRKRIR Products

Bioinformatics Tool for PRKRIR Antibody (H00005612-M01)

Discover related pathways, diseases and genes to PRKRIR Antibody (H00005612-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKRIR Antibody (H00005612-M01)

Discover more about diseases related to PRKRIR Antibody (H00005612-M01).
 

Pathways for PRKRIR Antibody (H00005612-M01)

View related products by pathway.

PTMs for PRKRIR Antibody (H00005612-M01)

Learn more about PTMs related to PRKRIR Antibody (H00005612-M01).

Blogs on PRKRIR

There are no specific blogs for PRKRIR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRKRIR Antibody (1C10-1A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKRIR
Entrez
OMIM
Uniprot