PRKRIP1 Antibody

Images

 
Western Blot: PRKRIP1 Antibody [NBP1-54890] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRKRIP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PRKRIP1(PRKR interacting protein 1 (IL11 inducible)) The peptide sequence was selected from the N terminal of PRKRIP1. Peptide sequence MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKRIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PRKRIP1 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRKRIP1 Antibody

  • C114
  • FLJ13902
  • FLJ40957
  • KRAB box domain containing 3
  • KRBOX3
  • likely ortholog of mouse C114 dsRNA-binding protein
  • PRKR interacting protein 1 (IL11 inducible)
  • PRKR-interacting protein 1

Background

PRKRIP1 binds double-stranded RNA.It inhibits EIF2AK2 kinase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-56745
Species: Hu
Applications: ICC/IF
NBP2-47466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for PRKRIP1 Antibody (NBP1-54890) (0)

There are no publications for PRKRIP1 Antibody (NBP1-54890).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRKRIP1 Antibody (NBP1-54890) (0)

There are no reviews for PRKRIP1 Antibody (NBP1-54890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRKRIP1 Antibody (NBP1-54890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRKRIP1 Products

Bioinformatics Tool for PRKRIP1 Antibody (NBP1-54890)

Discover related pathways, diseases and genes to PRKRIP1 Antibody (NBP1-54890). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKRIP1 Antibody (NBP1-54890)

Discover more about diseases related to PRKRIP1 Antibody (NBP1-54890).
 

Pathways for PRKRIP1 Antibody (NBP1-54890)

View related products by pathway.

PTMs for PRKRIP1 Antibody (NBP1-54890)

Learn more about PTMs related to PRKRIP1 Antibody (NBP1-54890).

Blogs on PRKRIP1

There are no specific blogs for PRKRIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRKRIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKRIP1
Uniprot