PREX2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PREX2 Antibody [NBP2-56590] - Staining of human cell line HEK 293 shows localization to endoplasmic reticulum.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PREX2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('HRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCLNSRKPLRVLVSTKP',)
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PREX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PREX2 Recombinant Protein Antigen (NBP2-56590PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PREX2 Antibody - BSA Free

• DEP domain-containing protein 2
• DEP.2
• DEPDC2
• phosphatidylinositol 34,5-trisphosphate-dependent Rac exchanger 2 protein
• phosphatidylinositol-34,5-trisphosphate-dependent Rac exchange factor 2
• P-REX2,6230420N16Rik
• PtdIns(34,5)-dependent Rac exchanger 2

Background

PREX2 functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDPfor free GTP. Its activity is synergistically activated by phosphatidylinositol-3,4,5-triphosphate and the beta gammasubunits of heterotrimeric G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PREX2