We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PRCC Recombinant Protein Antigen

Images

 
There are currently no images for PRCC Protein (NBP1-87153PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PRCC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRCC.

Source: E. coli

Amino Acid Sequence: RNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRCC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87153.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRCC Recombinant Protein Antigen

  • MGC17178
  • papillary renal cell carcinoma (translocation-associated)
  • Papillary renal cell carcinoma translocation-associated gene protein
  • proline-rich protein PRCC
  • RCCP1MGC4723
  • TPRC

Background

In a subset of papillary renal cell carcinomas, a t(X;1)(p11;q21) chromosome translocation has been repeatedly reported and is thought to be the cause of the cancer. As a result of the translocation, the transcription factor TFE3 on the X chromosome becomes fused to the PRCC (papillary renal cell carcinoma translocation-associated) gene on chromosome 1. The fused gene results in the fusion of N-terminal proline-rich region of the protein encoded by this gene to the entire TFE3 protein. This protein has been shown to interact with the mitotic checkpoint protein MAD2B, which suggests that the dominant-negative effect of the fusion protein with TFE3 may lead to a mitotic checkpoint defect.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-18540
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-44814
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-55877
Species: Hu
Applications: IHC,  IHC-P
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-57508
Species: Hu
Applications: IHC,  IHC-P, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-16451
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-90079
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87154
Species: Hu
Applications: COMET, ICC/IF, IHC,  IHC-P, KD, mIF, WB
NBP3-33527
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB100-74360
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
H00007942-M01
Species: Hu, Mu, Rt
Applications: ELISA, IB, ICC/IF,  IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-87153PEP
Species: Hu
Applications: AC

Publications for PRCC Protein (NBP1-87153PEP) (0)

There are no publications for PRCC Protein (NBP1-87153PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRCC Protein (NBP1-87153PEP) (0)

There are no reviews for PRCC Protein (NBP1-87153PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRCC Protein (NBP1-87153PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRCC Products

Blogs on PRCC

There are no specific blogs for PRCC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRCC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRCC