Recombinant Human PR48 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PR48 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-225 of Human PPP2R3B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

Protein/Peptide Type
Recombinant Protein
Gene
PPP2R3B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PR48 Protein

  • FLJ60425
  • NY-REN-8 antigen
  • NYREN8
  • PP2A subunit B isoform PR48
  • PP2A, subunit B, PR48 isoform
  • PPP2R3L
  • PPP2R3LY
  • PR48
  • protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
  • protein phosphatase 2, regulatory subunit B'', beta
  • Protein phosphatase 2A 48 kDa regulatory subunit
  • serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B
  • serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta

Background

Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87233
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
MAB6117
Species: Hu
Applications: WB, IHC
NBL1-14694
Species: Hu
NB200-581
Species: Hu, Rt
Applications: WB, IP
CD6
627-CD
Species: Hu
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-43801
Species: Hu
Applications: WB
NBP2-07799
Species: Hu
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB6130
Species: Mu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP2-49382
Species: Hu
Applications: IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-501
Species: Hu, Mu
Applications: WB, IP
NBP1-88958
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00028227-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for PR48 Recombinant Protein (H00028227-P01) (0)

There are no publications for PR48 Recombinant Protein (H00028227-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PR48 Recombinant Protein (H00028227-P01) (0)

There are no reviews for PR48 Recombinant Protein (H00028227-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PR48 Recombinant Protein (H00028227-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PR48 Products

Bioinformatics Tool for PR48 Recombinant Protein (H00028227-P01)

Discover related pathways, diseases and genes to PR48 Recombinant Protein (H00028227-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PR48 Recombinant Protein (H00028227-P01)

Discover more about diseases related to PR48 Recombinant Protein (H00028227-P01).
 

Pathways for PR48 Recombinant Protein (H00028227-P01)

View related products by pathway.

PTMs for PR48 Recombinant Protein (H00028227-P01)

Learn more about PTMs related to PR48 Recombinant Protein (H00028227-P01).
 

Research Areas for PR48 Recombinant Protein (H00028227-P01)

Find related products by research area.

Blogs on PR48

There are no specific blogs for PR48, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PR48 Antibody (2E12)
H00028227-M08

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PR48 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R3B