![Western Blot: PPP6C Antibody [H00005537-B01P] - Analysis of PPP6C expression in transfected 293T cell line by PPP6C polyclonal antibody. Lane 1: PPP6C transfected lysate(33.66 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PPP6C-Antibody-Western-Blot-H00005537-B01P-img0002.jpg "Western Blot: PPP6C Antibody [H00005537-B01P] - Analysis of PPP6C expression in transfected 293T cell line by PPP6C polyclonal antibody. Lane 1: PPP6C transfected lysate(33.66 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | PPP6C (AAH06990, 1 a.a. - 305 a.a.) full-length human protein. MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDSGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVLDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PPP6C |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | It has been used for WB and Functional. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PPP6C Antibody (H00005537-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PPP6C Antibody [H00005537-B01P] - Analysis of purified antibody to PPP6C on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/PPP6C-Antibody-Immunocytochemistry-Immunofluorescence-H00005537-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: PPP6C Antibody [H00005537-B01P] - Analysis of purified antibody to PPP6C on HeLa cell. (antibody concentration 10 ug/ml)")
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]](https://images.novusbio.com/images2/PP2A_AF3989_Western_Blot_5373.jpg)
![Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]](https://images.novusbio.com/images/af3989_phospho-pp2a-y307-catalytic-subunit-affinity-purified-pab-western-blot-12122025750418.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")