PPP2R5A Antibody - BSA Free

Western Blot: PPP2R5A Antibody [NBP1-53663] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Western Blot: PPP2R5A Antibody [NBP1-53663] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PPP2R5A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PPP2R5A(protein phosphatase 2, regulatory subunit B', alpha isoform) The peptide sequence was selected from the N terminal of PPP2R5A. Peptide sequence YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R5A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PPP2R5A Antibody - BSA Free

• B56A
• MGC131915
• PP2A B subunit isoform B56-alpha
• PP2A B subunit isoform B'-alpha
• PP2A B subunit isoform PR61-alpha
• PP2A B subunit isoform R5-alpha
• PP2A, B subunit, B' alpha isoform
• PP2A, B subunit, B56 alpha isoform
• PP2A, B subunit, PR61 alpha isoform
• PP2A, B subunit, R5 alpha isoform
• PR61A
• PR61alpha
• protein phosphatase 2, regulatory subunit B (B56), alpha isoform
• protein phosphatase 2, regulatory subunit B', alpha isoform
• protein phosphatase 2, regulatory subunit B', alpha
• serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, alphaisoform
• serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform

Background

PPP2R5A belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity.The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R5A
• Uniprot:
  • Q15172(Human)