PPP2R5A Antibody

Images

 
Western Blot: PPP2R5A Antibody [NBP1-53663] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.
Western Blot: PPP2R5A Antibody [NBP1-53663] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP2R5A Antibody Summary

Immunogen
Synthetic peptides corresponding to PPP2R5A(protein phosphatase 2, regulatory subunit B', alpha isoform) The peptide sequence was selected from the N terminal of PPP2R5A. Peptide sequence YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PPP2R5A and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PPP2R5A Antibody

  • B56A
  • MGC131915
  • PP2A B subunit isoform B56-alpha
  • PP2A B subunit isoform B'-alpha
  • PP2A B subunit isoform PR61-alpha
  • PP2A B subunit isoform R5-alpha
  • PP2A, B subunit, B' alpha isoform
  • PP2A, B subunit, B56 alpha isoform
  • PP2A, B subunit, PR61 alpha isoform
  • PP2A, B subunit, R5 alpha isoform
  • PR61A
  • PR61alpha
  • protein phosphatase 2, regulatory subunit B (B56), alpha isoform
  • protein phosphatase 2, regulatory subunit B', alpha isoform
  • protein phosphatase 2, regulatory subunit B', alpha
  • serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, alphaisoform
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform

Background

PPP2R5A belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity.The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBL1-14694
Species: Hu
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-87233
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-31587
Species: Hu
Applications: IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
302-B2/CF
Species: Hu
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-33470
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58453
Species: Hu
Applications: ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-46622
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for PPP2R5A Antibody (NBP1-53663) (0)

There are no publications for PPP2R5A Antibody (NBP1-53663).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5A Antibody (NBP1-53663) (0)

There are no reviews for PPP2R5A Antibody (NBP1-53663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R5A Antibody (NBP1-53663) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2R5A Products

Bioinformatics Tool for PPP2R5A Antibody (NBP1-53663)

Discover related pathways, diseases and genes to PPP2R5A Antibody (NBP1-53663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R5A Antibody (NBP1-53663)

Discover more about diseases related to PPP2R5A Antibody (NBP1-53663).
 

Pathways for PPP2R5A Antibody (NBP1-53663)

View related products by pathway.

PTMs for PPP2R5A Antibody (NBP1-53663)

Learn more about PTMs related to PPP2R5A Antibody (NBP1-53663).
 

Research Areas for PPP2R5A Antibody (NBP1-53663)

Find related products by research area.

Blogs on PPP2R5A

There are no specific blogs for PPP2R5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R5A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R5A
Uniprot