We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PPP2R2B Recombinant Protein Antigen

Images

 
There are currently no images for PPP2R2B Recombinant Protein Antigen (NBP2-46667PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPP2R2B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP2R2B.

Source: E. coli

Amino Acid Sequence: YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP2R2B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46667.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPP2R2B Recombinant Protein Antigen

  • B55BETA
  • FLJ95686
  • MGC24888
  • PP2A subunit B isoform B55-beta
  • PP2A subunit B isoform beta
  • PP2A subunit B isoform PR55-beta
  • PP2A subunit B isoform R2-beta
  • PP2A, subunit B, B-beta isoform
  • PP2AB55BETA
  • PP2ABBETA
  • PP2APR55B
  • PP2APR55BETA
  • PR2AB55BETA
  • PR2ABBETA
  • PR2APR55BETA
  • PR52B
  • PR55BETA
  • PR55-BETA
  • protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform
  • protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform
  • protein phosphatase 2, regulatory subunit B, beta
  • SCA12
  • serine/threonine protein phosphatase 2A, 55 kDa regulatory subunit B, betaisoform
  • serine/threonine protein phosphatase 2A, neuronal isoform
  • serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B betaisoform
  • spinocerebellar ataxia 12

Background

The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. This gene encodes a beta isoform of the regulatory subunit B55 subfamily. Defects in the 5' UTR of this gene may cause a rare form of autosomal dominant spinocerebellar ataxia 12 (SCA12).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-25371
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-17155
Species: Hu
Applications: IHC,  IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-90063
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-14336
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32535
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, Simple Western, WB
NBP2-81078
Species: Ha, Hu
Applications: ELISA, ICC/IF, IHC, IP, WB
NB110-58346
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-56984
Species: Hu
Applications: ICC/IF
NBP1-69006
Species: Hu
Applications: WB
H00003748-M01
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
NB120-5908
Species: Hu, Mu, Rt
Applications: ICC/IF, WB

Publications for PPP2R2B Recombinant Protein Antigen (NBP2-46667PEP) (0)

There are no publications for PPP2R2B Recombinant Protein Antigen (NBP2-46667PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R2B Recombinant Protein Antigen (NBP2-46667PEP) (0)

There are no reviews for PPP2R2B Recombinant Protein Antigen (NBP2-46667PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPP2R2B Recombinant Protein Antigen (NBP2-46667PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP2R2B Products

Research Areas for PPP2R2B Recombinant Protein Antigen (NBP2-46667PEP)

Find related products by research area.

Blogs on PPP2R2B

There are no specific blogs for PPP2R2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IP3R1 Antibody
NB120-5908

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPP2R2B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R2B