PPP1R12C Antibody - BSA Free

Immunohistochemistry-Paraffin: PPP1R12C Antibody [NBP1-94079] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Staining of human lymphoid node shows strong cytoplasmic and membranous positivity in germinal and non germinal center cells.

Staining of human testis shows strong cytoplasmic and membranous positivity in Leydig cells.

Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPP1R12C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPP1R12C Antibody - BSA Free (NBP1-94079) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP1R12C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PPP1R12C Protein (NBP1-94079PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PPP1R12C Antibody - BSA Free

• DKFZp434D0412
• LENG3
• leukocyte receptor cluster (LRC) encoded novel gene 3
• leukocyte receptor cluster (LRC) member 3
• MBS85
• myosin-binding subunit 85
• p84
• p85
• protein phosphatase 1 myosin-binding subunit of 85 kDa
• protein phosphatase 1 myosin-binding subunit p85
• protein phosphatase 1 regulatory subunit 12C
• protein phosphatase 1, regulatory (inhibitor) subunit 12C
• protein phosphatase 1, regulatory subunit 12C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R12C