PPIL4 Antibody

Images

 
Independent Antibodies: Western Blot: PPIL4 Antibody [NBP2-55080] - Analysis using Anti-PPIL4 antibody NBP2-55080 (A) shows similar pattern to independent antibody NBP1-85921 (B).
Immunocytochemistry/ Immunofluorescence: PPIL4 Antibody [NBP2-55080] - Staining of human cell line SiHa shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

PPIL4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRS
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPIL4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPIL4 Recombinant Protein Antigen (NBP2-55080PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PPIL4 Antibody

  • Cyclophilin-like protein PPIL4
  • cyclophilin-type peptidyl-prolyl cis-trans isomerase
  • EC 5.2.1.8
  • HDCME13P
  • peptidyl-prolyl cis-trans isomerase-like 4
  • peptidylprolyl isomerase (cyclophilin)-like 4
  • PPIase
  • Rotamase PPIL4
  • serologically defined breast cancer antigen NY-BR-18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP3-00253
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
AF3589
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
MAB3777
Species: Hu, Mu, Rt
Applications: WB
MAB7670
Species: Hu
Applications: ICC, WB
MAB2294
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-85364
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97946
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-38604
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00009360-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, IF, IHC, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-1397
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-15079
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP3-00140
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-55080
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for PPIL4 Antibody (NBP2-55080) (0)

There are no publications for PPIL4 Antibody (NBP2-55080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPIL4 Antibody (NBP2-55080) (0)

There are no reviews for PPIL4 Antibody (NBP2-55080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPIL4 Antibody (NBP2-55080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPIL4 Products

Bioinformatics Tool for PPIL4 Antibody (NBP2-55080)

Discover related pathways, diseases and genes to PPIL4 Antibody (NBP2-55080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPIL4 Antibody (NBP2-55080)

Discover more about diseases related to PPIL4 Antibody (NBP2-55080).
 

Pathways for PPIL4 Antibody (NBP2-55080)

View related products by pathway.

Blogs on PPIL4

There are no specific blogs for PPIL4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPIL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIL4