PPIL3 Antibody

Images

 
Western Blot: PPIL3 Antibody [NBP2-13794] - Analysis in human cell line HEL.
Immunocytochemistry/ Immunofluorescence: PPIL3 Antibody [NBP2-13794] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal and non-germinal center cells.
Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human testis showing moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human small intestine shows strong cytoplamic postitiity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPIL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDV HIKDITIHANP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPIL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPIL3 Protein (NBP2-13794PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPIL3 Antibody

  • Cyclophilin J
  • cyclophilin-like protein 3
  • Cyclophilin-like protein PPIL3
  • CyPJ
  • EC 5.2.1.8
  • peptidyl-prolyl cis-trans isomerase-like 3
  • peptidylprolyl cis-trans isomerase-like protein 3
  • peptidylprolyl isomerase (cyclophilin)-like 3
  • PPIase
  • PPIase-like protein 3
  • Rotamase PPIL3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-00253
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB3777
Species: Hu, Mu, Rt
Applications: WB
MAB7670
Species: Hu
Applications: ICC, WB
MAB2294
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-85364
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38604
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97946
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00009360-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-1397
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP3-00140
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-15079
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-13794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPIL3 Antibody (NBP2-13794) (0)

There are no publications for PPIL3 Antibody (NBP2-13794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPIL3 Antibody (NBP2-13794) (0)

There are no reviews for PPIL3 Antibody (NBP2-13794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPIL3 Antibody (NBP2-13794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPIL3 Products

Bioinformatics Tool for PPIL3 Antibody (NBP2-13794)

Discover related pathways, diseases and genes to PPIL3 Antibody (NBP2-13794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPIL3 Antibody (NBP2-13794)

Discover more about diseases related to PPIL3 Antibody (NBP2-13794).
 

Pathways for PPIL3 Antibody (NBP2-13794)

View related products by pathway.

Blogs on PPIL3

There are no specific blogs for PPIL3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPIL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIL3