PPIL3 Antibody


Western Blot: PPIL3 Antibody [NBP2-13794] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: PPIL3 Antibody [NBP2-13794] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794] - Staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: PPIL3 Antibody [NBP2-13794] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PPIL3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDV HIKDITIHANP
Specificity of human, mouse, rat PPIL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPIL3 Protein (NBP2-13794PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PPIL3 Antibody

  • Cyclophilin J
  • cyclophilin-like protein 3
  • Cyclophilin-like protein PPIL3
  • CyPJ
  • EC
  • peptidyl-prolyl cis-trans isomerase-like 3
  • peptidylprolyl cis-trans isomerase-like protein 3
  • peptidylprolyl isomerase (cyclophilin)-like 3
  • PPIase
  • PPIase-like protein 3
  • Rotamase PPIL3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPIL3 Antibody (NBP2-13794) (0)

There are no publications for PPIL3 Antibody (NBP2-13794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPIL3 Antibody (NBP2-13794) (0)

There are no reviews for PPIL3 Antibody (NBP2-13794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPIL3 Antibody (NBP2-13794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPIL3 Products

Bioinformatics Tool for PPIL3 Antibody (NBP2-13794)

Discover related pathways, diseases and genes to PPIL3 Antibody (NBP2-13794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPIL3 Antibody (NBP2-13794)

Discover more about diseases related to PPIL3 Antibody (NBP2-13794).

Pathways for PPIL3 Antibody (NBP2-13794)

View related products by pathway.

Blogs on PPIL3

There are no specific blogs for PPIL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPIL3 Antibody and receive a gift card or discount.


Gene Symbol PPIL3