PPIH Recombinant Protein Antigen

Images

 
There are currently no images for PPIH Protein (NBP2-32416PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPIH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPIH.

Source: E. coli

Amino Acid Sequence: VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPIH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32416.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPIH Recombinant Protein Antigen

  • cyclophilin H
  • CYP20
  • CypH
  • CYPHpeptidyl prolyl isomerase H (cyclophilin H)
  • EC 5.2.1.8
  • MGC5016
  • peptidyl-prolyl cis-trans isomerase H
  • peptidylprolyl isomerase H (cyclophilin H)
  • PPIase H
  • Rotamase H
  • Small nuclear ribonucleoprotein particle-specific cyclophilin H
  • SnuCyp-20
  • USA-CyP SnuCyp-20
  • USA-CYPCYP-20
  • U-snRNP-associated cyclophilin SnuCyp-20
  • U-snRNP-associated cyclophilin SunCyp-20

Background

PPIases accelerate the folding of proteins. It catalyzes the cis trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri snRNP complex. May act as a chaperone. The protein encoded by this gene is a member of the peptidyl prolyl cis trans isomerase (PPIase) family. PPIases catalyze the cis trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-92297
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-92372
Species: Hu
Applications: IHC,  IHC-P
NBP1-83218
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15079
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00009360-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB400-140
Species: Hu, Mu(-), Rb
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB7788
Species: Hu
Applications: Simple Western, WB
NBP1-82999
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-75752
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-45382
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-48733
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
H00001594-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-38160
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-16627
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF4174
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
MAB3777
Species: Hu, Mu, Rt
Applications: WB

Publications for PPIH Protein (NBP2-32416PEP) (0)

There are no publications for PPIH Protein (NBP2-32416PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPIH Protein (NBP2-32416PEP) (0)

There are no reviews for PPIH Protein (NBP2-32416PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPIH Protein (NBP2-32416PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPIH Products

Research Areas for PPIH Protein (NBP2-32416PEP)

Find related products by research area.

Blogs on PPIH

There are no specific blogs for PPIH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPIH Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIH