PPIH Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PPIH Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPIH.
  
  

  Source: E. coli

  Amino Acid Sequence: VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PPIH
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32416.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPIH Recombinant Protein Antigen

• cyclophilin H
• CYP20
• CypH
• CYPHpeptidyl prolyl isomerase H (cyclophilin H)
• EC 5.2.1.8
• MGC5016
• peptidyl-prolyl cis-trans isomerase H
• peptidylprolyl isomerase H (cyclophilin H)
• PPIase H
• Rotamase H
• Small nuclear ribonucleoprotein particle-specific cyclophilin H
• SnuCyp-20
• USA-CyP SnuCyp-20
• USA-CYPCYP-20
• U-snRNP-associated cyclophilin SnuCyp-20
• U-snRNP-associated cyclophilin SunCyp-20

Background

PPIases accelerate the folding of proteins. It catalyzes the cis trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri snRNP complex. May act as a chaperone. The protein encoded by this gene is a member of the peptidyl prolyl cis trans isomerase (PPIase) family. PPIases catalyze the cis trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PPIH