PPIG Antibody - BSA Free

Immunohistochemistry-Paraffin: PPIG Antibody [NBP2-49256] - Staining of human cerebral cortex shows nuclear positivity in neurons and glial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPIG Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPIG Antibody - BSA Free (NBP2-49256) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPIG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PPIG Recombinant Protein Antigen (NBP2-49256PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPIG Antibody - BSA Free

• CARS-cyclophilin
• CARS-CypPPIase G
• CASP10
• Clk-associating RS-cyclophilin
• Cyclophilin G
• CYP
• EC 5.2.1.8
• MGC133241
• peptidyl-prolyl cis-trans isomerase G
• peptidylprolyl isomerase G (cyclophilin G)
• peptidyl-prolyl isomerase G (cyclophilin G)
• Peptidyl-prolyl isomerase G
• Rotamase G
• SCAF10
• SR-cyclophilin
• SRCyp
• SR-cyp
• SR-related CTD-associated factor 10

Background

SR cyclophilin (SRcyp) is also known as peptidyl-prolyl cis-trans isomerase G. Cyclophilins are peptidyl-prolyl isomerases (PPIases) that accelerate the folding of proteins by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. The function of cyclophilins is poorly understood, but their function has been linked to multiple cellular processes such as protein folding, trafficking, and chaperone activity. SRcyp is a member of the Moca family of nuclear cyclophilins and is phosphorylated in a cell cycle dependent manner. There is evidence that SRcyp may be involved in the regulation of gene expression and mRNA splicing. Alternative names for SRcyp include PPIase G, rotamase G, cyclophilin G, clk-associating RS-cyclophilin, CARS-cyclophilin, SR-cyp, CASP10, and PPIG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPIG